KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_05349Help
Entry
BMULJ_05349       CDS       T00740                                 

Gene name
shc
Definition
(GenBank) squalene cyclase
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:complement(2454434..2456407)
Genome map
AA seq 657 aa AA seqDB search
MNDLTDMATLSAGTVPAELDAAVARATDALLAAQNADGHWVYELEADSTIPAEYVLLVHY
LGETPNLELEQKIGRYLRRIQQADGGWPLFTDGAPNISASVKAYFALKVIGDDENAEHMQ
RARRAIHAMGGAEMSNVFTRIQLALYGAIPWRAVPMMPVEIMLLPQWFPFHLSKVSYWAR
TVIVPLLVLNAKRPLAKNPRGVRIDELFIDPPVNAGLLPRQGHQSAGWFAFFRAVDHVLR
AVDGLFPAYTRERAIRQAVAFVDERLNGEDGLGAIYPAMANAVMMYDVLGYAEDHPNRAI
ARKSIEKLLVVHEDEAYCQPCLSPVWDTSLAAHALLETRDPRAEQAAVRGLDWLRPLQIL
DVRGDWISRRPHVRPGGWAFQYANPHYPDVDDTAVVAMAMDRAQKLNQSDTYRESIARAR
EWVVGMQSSDGGWGAFEPENTQYYLNNIPFSDHGALLDPPTADVSGRCLSMLSQLGETAL
NSDAARRALDYMLKEQEPDGSWYGRWGMNYVYGTWTALCALNAAGLGPDDARVKRAAQWL
LSIQNKDGGWGEDGDSYKLNYRGYEPAPSTASQTAWALLGLMAAGEVNNPAVKRGIDYLI
AEQKEHGLWDEARFTATGFPRVFYLRYHGYRKFFPLWALARYRNLKRDNTTRVTVGI
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatctcaccgatatggctaccctgtcggccggcaccgtgccggccgagctcgat
gcggccgtcgcacgcgcgaccgacgcgctgctcgccgcgcagaacgcggacgggcactgg
gtctacgaactcgaagccgattcgacgattcccgccgaatacgtgctgctcgtccactat
ctcggcgagacgccgaacctcgagctcgaacagaagatcggccgctatctgcgccggatc
cagcaggccgacggcggctggccgctgtttaccgacggcgcaccgaacatcagcgcgagc
gtgaaggcgtacttcgcgctgaaggtgatcggcgacgacgaaaacgccgagcacatgcag
cgcgcgcgtcgcgcgatccacgcgatgggcggcgccgagatgtcgaacgtgttcacgcgg
attcagctcgcgttgtacggcgcgattccgtggcgcgcggtgccgatgatgccggtcgag
atcatgctgctgccgcagtggttcccgttccatctgtcgaaggtgtcgtactgggcgcgc
acggtgatcgtgccgctgctcgtgctgaatgcgaagcgaccgcttgcgaagaatccgcgc
ggcgtccgcatcgacgaactgttcatcgatccgcccgtcaacgcgggcctgctgccgcgc
cagggtcaccagagcgccggctggttcgcgttcttccgtgcggtcgatcacgtgctgcgc
gcggtcgacgggctgtttccggcttatacgcgcgagcgcgcgattcgtcaggccgtcgcg
ttcgtcgacgagcggctgaacggcgaggacggcctcggcgcgatctatccggcgatggcc
aacgcggtgatgatgtacgacgtgctcggctacgcggaagatcatccgaatcgcgcgatc
gcgcgcaagtcgatcgagaagctgctcgtcgtgcacgaagacgaagcgtattgccagccg
tgtctgtcgcccgtctgggatacctcgctcgccgcgcatgcgctgctcgagacgcgcgat
ccgcgcgccgagcaggcggccgtgcgcggcctcgactggctgcgtccgctgcagatcctc
gacgtgcgcggcgactggatctcgcgccgtccgcacgtgcgtcccggcggctgggcgttc
cagtacgcgaacccgcactaccccgacgtcgacgatacggccgtcgtcgcgatggcgatg
gatcgcgcgcaaaagctgaaccagtccgacacgtatcgcgagtcgatcgcgcgtgcgcgc
gagtgggtcgtcggcatgcagagcagcgacggcggctggggcgcgttcgagccggaaaac
acgcagtactacctgaacaacatcccgttctccgatcacggcgcgctgctcgatccgccg
acggccgacgtgtcgggccgctgtctgtcgatgctgtcgcagctcggcgaaaccgcgctg
aacagcgacgcggcgcgccgcgcgctcgactacatgctgaaggagcaggagccggacggc
agctggtacggccgctgggggatgaactacgtgtacggcacgtggacggcgctgtgcgcg
ctgaatgcggctggcctcgggcccgacgacgcgcgcgtgaagcgcgcggcgcaatggctg
ctgtcgatccagaacaaggacggcggctggggcgaggacggcgacagctacaagctgaac
taccgcggctacgagcccgcaccgagcacggcatcgcagacggcctgggcgctgctcggc
ctgatggcggccggcgaggtgaacaacccggcggtcaagcgcgggatcgactatctgatc
gccgaacagaaggagcacggcctgtgggacgaagcgcgcttcactgcgaccggcttcccg
cgcgtgttctatctgcgctatcacggctatcgcaagttcttcccgctgtgggcgctggcg
cgctaccgcaacctgaagcgcgacaacacgacgcgcgtcacggtcgggatctga

DBGET integrated database retrieval system