KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_05351Help
Entry
BMULJ_05351       CDS       T00740                                 

Gene name
crtB
Definition
(GenBank) phytoene synthase
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SQS_PSY
Motif
Other DBs
NCBI-ProteinID: BAG47188
UniProt: A0A0H3KPN6
Position
2:complement(2457677..2458525)
Genome map
AA seq 282 aa AA seqDB search
MAVSNLVVDEQETDAAAVTSGSSFYLAMRILPAVQRDAMFQVYAFCRAVDDIADSDLPRA
ERAAGLERWRADIDACFAGHPPRHLVALEREIRAFDLQRDDFHAMIDGMAMDAAEDICAP
DEPTLDLYCDRVASAAGRLSVRIFGMPEAEGIKLSHHLGRALQLTNILRDIDDDAAINRC
YLPRELLQREGIAISDPATIARDPALPRVCATLVERALEHFRQADAVMDTCARAQVKAPR
IMSGAYRCILEAAVARGFAAPRAPLRKPKARMLMIAARYALF
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
ttggccgtttccaatctcgtcgtggacgaacaagaaaccgacgccgctgccgtcacatcg
ggcagttctttctacctcgcgatgcgcatcctgccggccgtgcagcgcgacgcgatgttc
caggtctacgcgttctgccgcgcggtggacgacatcgccgacagcgacctgccgcgcgcc
gagcgcgccgcgggcctcgaacgctggcgcgccgacatcgacgcgtgcttcgccggccat
ccgccgcgccatctggtcgcgctcgagcgcgaaatccgcgcattcgatctgcagcgcgac
gacttccacgcgatgatcgacgggatggcgatggacgccgccgaggatatctgcgcgccc
gacgagccgacgctcgacctctattgcgaccgcgtggcgagcgcggccggccggctgtcg
gtgaggattttcgggatgccggaagccgaaggcatcaagctgtcgcaccacctcggccgc
gcgctgcaattgacgaacatcctgcgcgacatcgacgacgacgcggcgatcaaccgctgc
tatctgccgcgcgaactgctgcagcgcgaagggatcgcgatttccgatccggcgacgatc
gcgcgcgaccccgcgttgccgcgcgtgtgcgcgacgctcgtcgaacgcgcgctcgaacat
ttcaggcaggccgatgcggtgatggacacctgcgcacgcgcgcaggtgaaggcgccgcgg
atcatgtcgggcgcatatcgctgcattctcgaggcggcggtggcccgcggctttgcggca
ccgcgtgcgccgctgcgcaagccgaaggcgcggatgctgatgatcgccgcgcgctacgcg
ctgttctga

DBGET integrated database retrieval system