KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_05353Help
Entry
BMULJ_05353       CDS       T00740                                 

Gene name
estC
Definition
(GenBank) putative esterase
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Hydrolase_4 Abhydrolase_1 LCAT PGAP1 Ser_hydrolase Esterase Abhydrolase_5 Peptidase_S9 DUF676 DUF915 DUF2974
Motif
Other DBs
NCBI-ProteinID: BAG47190
UniProt: A0A0H3KU89
Position
2:2459360..2460244
Genome map
AA seq 294 aa AA seqDB search
METNVTAPSQSDHPVFVLVHGAWHGAWCFAHVAAALAARGHLSIARDLPAHGLHARFPVS
YHVRPLDKDAFGAEPSPVANTTLDDYATQVMQAVDDAYALGRGKVILVGHSMGGLAITAA
AERAPDKIAKLVYLAAFMPAAGVPGLDYVRAPENRGELLGPLMLASPRVAGALRIDPRSG
DADYRAATRRALCDDVPQADFDAVANLMSCDVPAAPFATAIPTTAARWGAIDRHYIKCLQ
DRVLLPALQQRFIDEADAFAPGNPTHVHQLDSSHSPFMSQPAVLAGVLADIAKH
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggagacgaacgtgaccgccccttcgcagtccgatcacccggttttcgtgctcgtgcac
ggcgcatggcatggcgcgtggtgcttcgcgcacgtcgccgccgcgctggccgcgcgcggc
catctgtcgatcgcgcgcgatctgcccgcgcacggcctccacgcgcgctttcccgtgtcg
tatcacgtgcggccgctcgacaaggacgcgttcggcgccgagccctcgccggtcgcgaac
acgacgctcgacgattacgcgacgcaggtgatgcaggcggtcgacgacgcatacgcgctc
ggccgcggcaaggtgatcctggtcggccacagcatgggcggcctcgcgatcacggccgcc
gccgaacgcgcgcccgacaagattgcgaagctcgtctatctggccgccttcatgccggcc
gcgggcgtgccgggtctcgactacgtgcgcgcgccggagaaccgcggggaattgctcggc
ccgctgatgctcgcgagcccgcgcgttgccggtgcgttgcggatcgacccgcgcagcggc
gacgccgactatcgcgccgcgacgcgccgcgcactttgcgacgacgttccgcaagccgac
ttcgacgcggtggcgaacctgatgagctgcgacgtgccggccgcgccgttcgcgaccgcg
atcccgacgaccgccgcgcgatggggcgcgatcgatcgccactacatcaagtgtctgcag
gatcgcgtactgctgccggcgctgcagcagcgcttcatcgacgaagccgatgcgttcgcg
cccggcaacccgacgcacgtgcatcagctcgacagcagccattcgccgttcatgtcgcag
ccggccgtgctcgccggcgtgctggccgacatcgcgaagcactga

DBGET integrated database retrieval system