KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_05650Help
Entry
BMULJ_05650       CDS       T00740                                 

Gene name
fruK
Definition
1-phosphofructokinase (EC:2.7.1.56)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMULJ_05650 (fruK)
   01230 Biosynthesis of amino acids
    BMULJ_05650 (fruK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMULJ_05650 (fruK)
   00030 Pentose phosphate pathway
    BMULJ_05650 (fruK)
   00051 Fructose and mannose metabolism
    BMULJ_05650 (fruK)
   00052 Galactose metabolism
    BMULJ_05650 (fruK)
  Energy metabolism
   00680 Methane metabolism
    BMULJ_05650 (fruK)
Enzymes [BR:bmj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BMULJ_05650 (fruK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:329798..330733
Genome map
AA seq 311 aa AA seqDB search
MTDIVTVTLNPAVDVATSVEHIVDTHKLRCARPRRDPGGGGINVARTIHRLGGDCVALYL
AGGPTGDVLTLLLEAERLPAVRIRIAGETRENVCVTETATGREYRFLMPGPLVTEAEWRD
CAARIDTLHPAPRYLVLSGSLPPGAPDDLYATLARTARARGSRVVVDAAGRALQAALEAG
VHLVKPSLGELSALAGEPLDETSACRKASELVARGQADIVALTLGARGAWVVTRDGALRL
PGRPATVCSTVGAGDSFVGGMVWALARGVPFDEACRYALAASAASVEHPGTALCTRDDVE
RIHAELVAQAS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatatcgttaccgttaccctgaatccggccgtcgatgtcgcgacgtccgtcgag
cacatcgtcgatacgcacaagctgcgctgtgcacggccgcggcgcgaccccggcggcggc
gggatcaacgttgcccgaaccattcaccgcctcgggggcgactgcgtcgcgctgtacctg
gccggcgggccgaccggcgacgtcctgacgctgctgctcgaagccgagcgtctgccggcg
gtgcgcatccggatcgccggcgagacgcgcgagaacgtctgcgtgaccgagaccgcgacc
gggcgcgagtaccgcttcctgatgcccgggccgttggtcaccgaggccgagtggcgcgac
tgcgcagcccgcatcgacaccctgcacccggcgccgcgctatctcgtgttgagcggcagc
ctgccgcccggcgcgcccgacgatctgtatgcgacgctggcgcggacggccagggcgagg
ggcagccgggtggtcgtcgacgcggcggggcgggcactgcaagctgctctcgaggccggc
gttcatctcgtgaagcccagtctcggcgaactgagcgcgttggccggcgagccgctcgac
gagacgtcggcatgccggaaggccagcgaactcgtggcgcgaggacaagccgacatcgtc
gcgttgacgctcggtgcgcgcggcgcatgggtcgtcacgcgcgacggcgcgctgcgcctg
cccggcaggccggcaacggtatgcagcacggtcggggccggcgacagtttcgtcggcggc
atggtctgggcgctggcgcgcggcgtgccgttcgacgaagcgtgccgctatgcgctggcg
gcttcggccgcttcggtcgagcatccggggacggcgctgtgcacgcgcgacgacgtcgag
cggattcacgctgaactggttgcgcaagcaagctga

DBGET integrated database retrieval system