KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_05650Help
Entry
BMULJ_05650       CDS       T00740                                 

Gene name
fruK
Definition
(GenBank) 1-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
bmj00010  Glycolysis / Gluconeogenesis
bmj00030  Pentose phosphate pathway
bmj00051  Fructose and mannose metabolism
bmj00052  Galactose metabolism
bmj00680  Methane metabolism
bmj01100  Metabolic pathways
bmj01110  Biosynthesis of secondary metabolites
bmj01120  Microbial metabolism in diverse environments
bmj01130  Biosynthesis of antibiotics
bmj01200  Carbon metabolism
bmj01230  Biosynthesis of amino acids
Module
bmj_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMULJ_05650 (fruK)
   00030 Pentose phosphate pathway
    BMULJ_05650 (fruK)
   00051 Fructose and mannose metabolism
    BMULJ_05650 (fruK)
   00052 Galactose metabolism
    BMULJ_05650 (fruK)
  Energy metabolism
   00680 Methane metabolism
    BMULJ_05650 (fruK)
Enzymes [BR:bmj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BMULJ_05650 (fruK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin FtsQ
Motif
Other DBs
NCBI-ProteinID: BAG47477
UniProt: A0A0H3KV11
Position
3:329798..330733
Genome map
AA seq 311 aa AA seqDB search
MTDIVTVTLNPAVDVATSVEHIVDTHKLRCARPRRDPGGGGINVARTIHRLGGDCVALYL
AGGPTGDVLTLLLEAERLPAVRIRIAGETRENVCVTETATGREYRFLMPGPLVTEAEWRD
CAARIDTLHPAPRYLVLSGSLPPGAPDDLYATLARTARARGSRVVVDAAGRALQAALEAG
VHLVKPSLGELSALAGEPLDETSACRKASELVARGQADIVALTLGARGAWVVTRDGALRL
PGRPATVCSTVGAGDSFVGGMVWALARGVPFDEACRYALAASAASVEHPGTALCTRDDVE
RIHAELVAQAS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatatcgttaccgttaccctgaatccggccgtcgatgtcgcgacgtccgtcgag
cacatcgtcgatacgcacaagctgcgctgtgcacggccgcggcgcgaccccggcggcggc
gggatcaacgttgcccgaaccattcaccgcctcgggggcgactgcgtcgcgctgtacctg
gccggcgggccgaccggcgacgtcctgacgctgctgctcgaagccgagcgtctgccggcg
gtgcgcatccggatcgccggcgagacgcgcgagaacgtctgcgtgaccgagaccgcgacc
gggcgcgagtaccgcttcctgatgcccgggccgttggtcaccgaggccgagtggcgcgac
tgcgcagcccgcatcgacaccctgcacccggcgccgcgctatctcgtgttgagcggcagc
ctgccgcccggcgcgcccgacgatctgtatgcgacgctggcgcggacggccagggcgagg
ggcagccgggtggtcgtcgacgcggcggggcgggcactgcaagctgctctcgaggccggc
gttcatctcgtgaagcccagtctcggcgaactgagcgcgttggccggcgagccgctcgac
gagacgtcggcatgccggaaggccagcgaactcgtggcgcgaggacaagccgacatcgtc
gcgttgacgctcggtgcgcgcggcgcatgggtcgtcacgcgcgacggcgcgctgcgcctg
cccggcaggccggcaacggtatgcagcacggtcggggccggcgacagtttcgtcggcggc
atggtctgggcgctggcgcgcggcgtgccgttcgacgaagcgtgccgctatgcgctggcg
gcttcggccgcttcggtcgagcatccggggacggcgctgtgcacgcgcgacgacgtcgag
cggattcacgctgaactggttgcgcaagcaagctga

DBGET integrated database retrieval system