KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_05684Help
Entry
BMULJ_05684       CDS       T00740                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
bmj00020  Citrate cycle (TCA cycle)
bmj00190  Oxidative phosphorylation
bmj00650  Butanoate metabolism
bmj01100  Metabolic pathways
bmj01110  Biosynthesis of secondary metabolites
bmj01120  Microbial metabolism in diverse environments
bmj01130  Biosynthesis of antibiotics
bmj01200  Carbon metabolism
Module
bmj_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bmj00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMULJ_05684 (sdhD)
   00650 Butanoate metabolism
    BMULJ_05684 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    BMULJ_05684 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: BAG47506
UniProt: A0A0H3KQM5
Position
3:367200..367568
Genome map
AA seq 122 aa AA seqDB search
MAANNRIGSKRLVVGAHYGLRDWLAQRVTATIMAVYTVILLVLFFGAHDFSYEGWASIFS
AQWMKLATFVTLLSLFYHAWVGVRDIWMDYVKPVGVRLLLQSLTIVWLLACAGYAAQILW
RV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaacaaccgaatcggctcgaagcgcctcgtcgtcggcgcgcactacggcctg
cgcgactggctcgcgcagcgcgtcaccgccacgatcatggcggtctacacggtcattctg
ctcgtcctgttcttcggcgcgcacgacttctcctacgaaggctgggcgtcgatcttctcc
gcacaatggatgaagctcgcgaccttcgtgacgctgctttccctcttctatcacgcatgg
gtcggcgtgcgcgacatctggatggactacgtgaagcccgtcggtgtgcgcctgctgctg
caatcgctgaccatcgtctggctgctcgcatgtgcgggctacgccgcgcagattctctgg
agagtgtaa

DBGET integrated database retrieval system