KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_06007Help
Entry
BMULJ_06007       CDS       T00740                                 

Gene name
glgB
Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bmj00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:735354..737552
Genome map
AA seq 732 aa AA seqDB search
MTDALFDRADIDALLGARHPDPFACLGPHAHDGRTIVRALLPGAEHVRVLAPDGAELGTL
ARVDDAGCFAGALAHDGRYRLAVEWPGARHVIDDPYAFGLLLDDAALARFAAGNPFAVLD
CLGAVPTCIDSVDGVRFAVWAPNAQRVSVVGDFNAWDGRRHPMRLRLPWGVWELFVPGIG
AGERYKYELRAADGRVLPHKADPCARATEAPPRTASIVADTGAVDGFAWHDHAWLQARAH
GDRYRRPWSIYEVHPESWQRYPEQMDRNATWDELAERLIPYVRGMGFTHVEFMPIAEYPF
GGSWGYQPLAQFAPSARFGPPDGFARFVDRAHAAGIGVLVDWVPAHFPDDPHGLAQFDGS
ALYEHADPREGMHPDWHTCVFNVGRNEVGAFLIASALAWARRYHVDGIRVDAVASMLYRD
YSRAAGEWVPNIYGGRENLESVAFLRALNDTLHGDDAPPGVVSVAEESTAWPGVTAPTRD
GGLGFDFKWNMGWMHDTLAYLHEDPVHRRYHHDRMTFGLVYAFSERFVLPLSHDEVVHGK
GSLASKMPGDAWQRLATLRAYFGFMWAHPGKKLLFMGSELAQWAEFAHDGTPHWDLLDAP
AHRGVQRLVRDLNRTYAAQPALHALDCDAAGFAWLIGDDRDNSVFAFARRDDAGHTVVAV
CNFTPVPRTGYRVGLPAPGAWRELMNTDAAVYGGTNAGNDGAVWAEDVPAHGEAWSATLR
LPPLATLWLSPA
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcgctgttcgaccgcgccgacatcgacgcgctgctcggcgcccgccatccc
gatccgttcgcgtgcctcgggccgcacgcgcacgacggccgcacgatcgtgcgcgcgctg
ctgcccggcgcggagcacgtgcgcgtgctggcgccggacggcgccgaactcggcacgctc
gcgcgcgtcgacgacgcgggctgcttcgccggcgcgctcgcgcacgacggccgctatcgg
cttgcggtcgaatggccgggcgcgcggcacgtgatcgacgacccttacgcgttcgggctg
ctgctcgacgatgcggcgctcgcgcgcttcgcggccggcaacccgttcgcggtgctcgac
tgcctcggcgcggtgccgacctgcatcgacagcgtcgacggcgtgcgcttcgcggtctgg
gcgccgaacgcgcaacgcgtgtcggtcgtcggcgacttcaatgcgtgggacggccgccgt
catccgatgcggctgcgtctgccgtggggcgtgtgggagctgttcgtgccggggatcggc
gcgggcgagcgctacaaatacgagctgcgcgcagccgacggacgcgtgctgccgcacaag
gccgacccgtgcgcgcgcgcgaccgaggcaccgccgcgtaccgcgtcgatcgtcgccgat
accggcgcggtcgacggcttcgcgtggcatgaccatgcgtggctgcaagcgcgcgcgcac
ggcgaccgctaccggcggccgtggtcgatctacgaggtgcatccggaatcgtggcagcgc
tatcccgagcagatggaccgcaacgcgacctgggacgaactcgccgaacggctgattccg
tacgtgcgcgggatgggcttcacgcatgtcgaattcatgccgatcgccgagtatccgttc
ggcggctcgtggggctaccagccgctcgcgcagttcgcgccgtccgcgcgcttcgggccg
cccgacggcttcgcgcgcttcgtcgaccgcgcgcatgcggccggcatcggcgtgctcgtc
gactgggtgcccgcgcacttccccgacgatccgcacgggctcgcgcagttcgacggcagc
gcgctgtacgagcatgccgacccgcgcgaaggcatgcatcccgactggcacacctgcgtg
ttcaacgtcggccgcaacgaggtcggcgcgttcctgatcgcgtcggcgctcgcatgggcg
cgccgctatcacgtcgacggcatccgcgtcgacgccgtcgcatcgatgctgtatcgcgac
tactcgcgcgcggccggcgaatgggtgccgaacatctacggcggccgcgagaacctcgaa
tcggtcgcattcctgcgcgcgctgaacgacacgctgcacggcgacgatgcgccgccgggc
gtcgtctcggtcgccgaggaatcgaccgcgtggccgggcgtcacggcgcccacgcgcgac
ggcgggctcggcttcgacttcaagtggaacatgggctggatgcacgacacgctcgcgtat
ctgcacgaggaccccgtgcatcgccgctatcaccacgaccgcatgacgttcgggctcgtc
tatgcgttctccgaacgcttcgtgctgccgctctcgcacgacgaggtcgtgcacggcaag
ggctcgctcgcgtcgaaaatgcccggcgacgcctggcagcggctcgcgacgctgcgcgcg
tacttcggcttcatgtgggcgcatcccggcaagaagctgctgttcatgggcagcgaactc
gcgcagtgggccgagttcgcgcacgacggcacgccgcactgggatctgctcgacgcgccc
gcgcatcgcggcgtgcagcggctcgtgcgcgacctgaaccgcacctatgcggcgcaaccc
gcgctgcatgcgctcgactgcgacgcggccggcttcgcctggctgatcggcgacgaccgc
gacaacagcgtgttcgcgttcgcgcgtcgcgacgatgcggggcacaccgtcgtcgccgtc
tgcaacttcacgcccgtgccgcgcaccggctatcgcgtcgggctgccggcgcccggcgcg
tggcgcgaactgatgaataccgacgccgccgtctacggcggcaccaatgccggcaacgac
ggcgccgtgtgggcggaggatgtgcctgcgcacggcgaggcgtggtcggccacgctacgg
ctgccaccgctcgccacgctatggctgagcccggcatga

DBGET integrated database retrieval system