KEGG   Burkholderia multivorans ATCC 17616 (Tohoku): BMULJ_06129Help
Entry
BMULJ_06129       CDS       T00740                                 

Gene name
galM
Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
bmj  Burkholderia multivorans ATCC 17616 (Tohoku)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bmj00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bmj00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3:complement(862075..863238)
Genome map
AA seq 387 aa AA seqDB search
MKRLWLQRAIAMIFLYATIGTAANAASPSADVSVHRSDYGVTRTGRAVSQYTLSNAHGVT
LKVITYGGIVTALEVPDRTGKVADIVLGFDSLADYEAHNGNIHFGALIGRYANRIAHGRF
SLDGNTWQLPLNDGPNTLHGGPDSFDAKVWTVTAARSDGQRASVTLRYVSPDGENGFPGT
LTTDVTYTLTNDDVIRIDYRATTDKDTVVNLTNHSYFNLAGHDSGSVERQLIEIDASRFT
PTDATSIPTGELASVAGTPMDLRAPTPIGARLRSAYPQLAMAHGYDHNWVLDHGGEAAPA
FAARAYDPASGRFLALYTTQPGLQFYTSNGLNGSVVGKGGTVYRQTDAFALEAEHFPDSP
NHPSFPTTVLKPGQTLHEVTLWKVGAR
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgactctggctgcagcgcgcaatcgccatgatcttcctgtacgcaacgatcggc
accgcggcgaacgcggcatcgccgtcggcggacgtatcggtccatcgcagcgactacggc
gtcacgcgcaccggtcgcgcggtgagccagtacacgctgagcaacgcgcacggcgtgacg
ctgaaagtcatcacgtacggcggcatcgtgacggcgctcgaagtgccggaccgaaccggc
aaggtcgccgacatcgtgctgggcttcgattcgctggccgactacgaagcgcacaacggc
aacattcatttcggcgcgctgatcggccgctacgcaaatcgcatcgcgcacgggcgtttc
tcgctcgacggcaacacgtggcagttgccgctcaacgacgggccgaacacgctgcacggc
gggcccgacagtttcgacgcgaaggtgtggacggtcaccgccgcgcgcagcgacggccag
cgtgcgagcgtcacgctgcgctacgtgagccccgacggcgagaacggctttcccggcacg
ctgacgacggacgtcacctacacgctgacgaacgacgacgtgatccgcatcgactatcgc
gcgacgaccgacaaggacaccgtcgtcaacctgacgaaccacagctatttcaatctcgcc
gggcacgacagcggcagcgtcgagcggcaattgatcgagatcgacgcgtcgcgcttcacg
ccgaccgacgcgacgtcgattccgaccggcgaactcgcgagcgtcgccggcacgccgatg
gatctgcgcgcgcccacgccgatcggtgcgcgcttgcgcagcgcgtatccgcaactcgcg
atggcgcacggctacgatcacaactgggtgctcgatcacggcggcgaagcggcgcccgcg
tttgcggcgcgcgcctacgatccggcgtcgggccgctttctcgcgctatacacgacgcag
ccggggctccagttctacacgtcgaacggcctgaacggcagcgtcgtcggcaagggcggc
accgtttatcggcaaacggatgcgttcgcgctcgaagccgagcatttccccgattcgccg
aatcatccgtcgttcccgacgaccgtgctgaagcctggccagacgttgcacgaagtgacg
ttgtggaaggtgggcgcacgatga

DBGET integrated database retrieval system