KEGG   Burkholderia mallei NCTC 10229: BMA10229_0018Help
Entry
BMA10229_0018     CDS       T00471                                 

Gene name
bdhA-2
Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bml00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    BMA10229_0018 (bdhA-2)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BMA10229_0018 (bdhA-2)
Enzymes [BR:bml01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     BMA10229_0018 (bdhA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(16818..17606)
Genome map
AA seq 262 aa AA seqDB search
MTSNLNGKAAIVTGAASGIGKEIALELARAGAAVAIADLNQDGANAVAELIEQAGGRAIG
VAMDVTNEDAVNAGIDKVAQTFSSVDILVSNAGIQIVNPIENYAFADWKKMQAIHVDGAF
LTTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHGLLGLARVLAKEGAKHNV
RSHVVCPGFVRTPLVDKQIPEQAKELGISEEEVVKKVMLGQTVDGVFTTVEDVAKTVLFL
SAFPSAALTGQSFVVSHGWFMQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgacttcgaacttgaacgggaaggcggccatcgtgacgggcgcggcgagcggcatcggc
aaggaaatcgcgctggagctcgcgcgcgcgggcgcggcggtggcgatcgccgatctgaac
caggacggcgcgaacgcggtggccgagctcatcgagcaggcgggcggccgggcgatcggc
gtggcgatggacgtgacgaacgaggacgcggtgaacgccggcatcgacaaggtcgcccag
acgttcagctcggtcgacattctcgtgtcgaacgcgggcatccagatcgtcaatccgatc
gagaactatgcgttcgccgactggaagaagatgcaggcgattcacgtcgacggcgcgttc
ctgacgacgaaggccgcgctcaagcacatgtacaaggacgatcgcggcggagtggtgatc
tacatgggctcggtgcattcgcacgaggcgtcgccgctgaagtcggcgtacgtgacggcc
aagcacgggctgctggggcttgcgcgcgtgctggcgaaggaaggcgcgaagcacaacgtg
cgctcgcatgtggtgtgcccgggcttcgtgcgcacgccgctcgtcgacaagcagattccg
gagcaggccaaggagctcggcatcagcgaagaggaggtggtgaagaaggtgatgctcggc
cagacggtggacggcgtgttcacgacggtcgaggacgtcgcgaagacggtgctgttcctg
tccgcgttcccgagcgcggcgctcaccggccagtcgttcgtcgtcagccacggctggttc
atgcagtaa

DBGET integrated database retrieval system