KEGG   Burkholderia mallei NCTC 10229: BMA10229_0082Help
Entry
BMA10229_0082     CDS       T00471                                 

Gene name
asnB-1
Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bml00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BMA10229_0082 (asnB-1)
Enzymes [BR:bml01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BMA10229_0082 (asnB-1)
Peptidases [BR:bml01002]
 Cysteine Peptidases
  Family C44
   BMA10229_0082 (asnB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:69699..71669
Genome map
AA seq 656 aa AA seqDB search
MCGITGFVGPVACAPQTARATLARMTDSLAHRGPDDTGLWIDHDAGVALGHRRLSIVDLS
EHGHQPMLSACGRYAMTFNGEIYNFRQLRSELEREHRAPEWRGHSDSEVLLAAFCAWGVD
RALQKAVGMFALALWNRESRVLTLARDRIGEKPLYYGRIGGSFVFGSELKALRRFPGFDA
HPIDRDALCLYLRHASVPAPYTIYEGIRKLPPGTYAQLEDLAEAPAPRRYWSLERAIAAG
RANPFDGDANAAVAQLDYVLRDAIAEQSVADVPLGAFLSGGVDSSVIVALMQTQTAQPVQ
TFTIGFHEAGYDEAGYAKAVARHLGTSHTELYVKPADVLATVPRMPCVYDEPFADSSQIP
TLLVSELTRRHVKVSLSGDGGDELFGGYTRYFLTPRLWGRLRRVPAAVRMRIAAALHALR
PDHADQIASLVQGAWSASAQRDASPRVGDRLHKLANVMTADSRASLYRLLMSSVHHPERF
TLAGHEPQTLIDTPGAWPAGLSFAEQAMAVDTLTYLPTDILTKVDRAAMAVSLETRMPFL
DHRVVEFAWRLPEALRIPDGQDKWLLRKLLYRYVPRPLIDRPKQGFCAPVGAWLRGELSD
WAAELLRPARLRDEGYLDAARVERLWRQHQSGRMNWQHPLWTVLMFQAWLERQRAE
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcaccggcttcgtgggccctgtcgcatgcgcgccgcagacggctcgcgcg
accctcgcgcgaatgacggacagtctcgcgcatcgcggcccggacgataccggtttgtgg
atcgatcacgacgcgggcgtcgcgctcggccatcggcgcctgtcgatcgtcgacttgtcc
gagcacgggcatcagccgatgctgtccgcgtgcggccgttatgcgatgacgttcaacggc
gagatctacaactttcgccagttgcgcagcgagctcgagcgcgaacatcgcgcgcccgaa
tggcgcggtcattcggatagcgaagtgttgctcgcggcgttctgcgcgtggggcgtcgat
cgcgcgttgcaaaaggcggtcggcatgttcgcgctcgcgctgtggaaccgcgaatcgcgc
gtgctcacgctcgcgcgcgatcgcatcggcgagaagccgctctattacggccgcatcggc
ggctcgttcgtgttcggctccgagctgaaggcgctgcggcgttttcccggcttcgacgcg
catccgatcgaccgcgacgcgctgtgcctgtatctgcgccacgcgagcgtgcccgcgccg
tacacgatctacgaaggcatccgcaagctgccgcccggcacgtacgcgcagctcgaggac
ctcgccgaagcgcccgcgccgcgccgctactggtcgctcgagcgcgcgatcgccgcaggc
cgcgcgaatccgttcgacggcgacgcgaacgccgccgtcgcgcagctcgattacgtgttg
cgcgacgcgatcgccgagcagtcggtcgccgacgtgccgctcggcgcgttcctgtcgggc
ggcgtcgattcgtcggtgatcgtcgcgctgatgcagacgcagaccgcgcagccggtgcag
accttcacgatcggctttcacgaggcgggctacgacgaggccggctatgcgaaggcggtt
gcgcggcatttgggcacgtcgcacaccgagctctacgtgaagccggccgacgtgctcgcg
accgtcccgcgcatgccgtgcgtctacgacgagccgttcgccgattcgtcgcagattccg
acgctgctcgtttccgagctcacccgccggcacgtgaaggtgagcctgtccggcgacggc
ggtgacgagctgttcggcggctacacgcgctatttcctgacgccgcgcctatgggggcgg
ctgcgccgcgtgccggccgcggtgcggatgcggatcgcggccgcgctgcacgcgctgcgg
cccgaccatgcggatcagatcgcctcgctcgtgcagggcgcgtggagcgcgtccgcgcag
cgcgacgcgtcgccgcgcgtcggggaccgcctgcacaagctcgcgaacgtgatgacggcg
gacagccgcgcgtcgctgtaccggttgctgatgtcgtcggtccatcatccggagcgcttc
acgctcgcggggcacgagccgcagacgctgatcgacacgccgggcgcgtggcccgccggg
ctgtcgttcgccgagcaggccatggccgtcgatacgctcacgtatctgccgaccgacatc
ctgacgaaagtcgaccgcgcggcgatggcggtgagcctcgagacgcggatgccgtttctc
gatcaccgcgtcgtcgagttcgcgtggcggctgccggaggcgctgcgcatcccggatggg
caggacaagtggttgctgcgcaagctgctgtatcgctacgtgccgcgcccgctgatcgac
cggccgaaacagggcttctgcgcgcccgtcggcgcgtggctgcgcggcgaattgagcgac
tgggcggcggagctgctgcgccccgcgcgcctgcgcgacgaaggctacctcgacgcggcg
cgcgtcgagcgcctgtggcggcagcaccagtcgggccggatgaactggcagcacccgctc
tggacggtgctgatgttccaggcatggctcgagcggcagcgcgccgagtag

DBGET integrated database retrieval system