KEGG   Burkholderia mallei NCTC 10229: BMA10229_0286Help
Entry
BMA10229_0286     CDS       T00471                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bml00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BMA10229_0286
Enzymes [BR:bml01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     BMA10229_0286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:272374..273672
Genome map
AA seq 432 aa AA seqDB search
MHVLVVGAGIAGLAAAWQLKRGGCDVTVVEAAERAGGRIRSAPFHGHVIECGAQFPSSGY
RHLMPLFGEAGLDAQLVKTSPWAAFEHRGRLFRVHARRPWTIPASGLLGWRDSVRVSRAR
AALLARVRALDPNRYAAFAEFDDADAAHWAERAFGRAAVDAIFAPMIHGLYFQPLRGASR
ALLAAVTGFDGADTLAVAGGWQTLPVALAARLDVRYGTRVDALSAHANGVDACVGDRALR
FDAAIVATPATVARRLWRGQTDAQRALLATGYARCAHVAFGLAPGWRAPARLRRVYGALL
SPHARRVAALTFERGRGIGDGQGEVVSAMLGHAGASALRYASDDEIARVALDDLRTLLPG
VAEAVVATRVQRWDEAEPLSPVGRARAIAAYRASIDARPRVLLAGDYMGSPWTDGAAETG
RWAARRLLDARA
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgcatgtactcgtcgtcggagcaggaatcgccgggctcgccgccgcctggcaactgaaa
cggggcggatgcgacgtgaccgtcgtcgaggccgccgaacgcgcgggcggccgcattcgc
agcgcgccgttccacggccatgtgatcgaatgcggcgcgcagtttccgtcctccggctat
cggcacttgatgccgctcttcggcgaggcggggctcgatgcgcaactcgtgaagacctcg
ccgtgggcggcgttcgagcatcgcgggcggctctttcgcgtgcatgcgcggcggccgtgg
acgatccccgcgagcggcctgctcggctggcgcgacagcgtgcgcgtgagccgggcgcgc
gctgcgctgctcgcgcgggttcgcgcgctcgatccgaaccgctatgcggcgttcgcggaa
ttcgacgatgccgacgcggcccactgggcggaacgcgcgttcgggcgcgcggcggtcgac
gcgatcttcgcgccgatgattcacgggctgtatttccagccgctgcgcggcgcgtcgcgc
gcgctgctcgcggccgtcaccggcttcgacggcgcggatacgctcgcggtcgcgggcggc
tggcagacgctgcccgtcgcgctcgcggcccggctcgacgtgcgctacggcacgcgggtc
gatgcgctgtcggcgcacgcgaacggcgtcgacgcgtgcgtcggcgatcgcgcgctgcgt
ttcgacgcggcgatcgtcgcgacgcccgcgaccgtcgcgcgccgcctctggcgcgggcag
accgacgcgcagcgcgcgctgctcgcgacgggctatgcacgctgcgcgcacgtcgcgttc
ggcctcgcgccgggctggcgcgcgcctgcgcggctgcgccgcgtgtacggcgcgctgctg
tcgccgcacgcgcgacgcgtcgcggcgctcacgttcgagcgcgggcgcgggatcggcgac
gggcagggcgaggtcgtatcggcgatgctcgggcatgcgggcgcgagcgcgctgcgctat
gcatcggacgacgagatcgcgcgcgtcgcgctcgacgacctgcgcacgctgttgccgggc
gtcgccgaggcggtcgtcgcgacgcgcgtgcagcgctgggacgaggccgagccgctgtcg
cccgtcggccgcgcgcgcgcgatcgccgcataccgcgcgagcatcgacgcgcgcccacgc
gtgctgctcgcgggcgactacatgggctcgccgtggaccgacggcgcggcggagacgggc
agatgggcggcgcgcaggctgctcgacgcgcgcgcatga

DBGET integrated database retrieval system