KEGG   Burkholderia mallei NCTC 10229: BMA10229_0331Help
Entry
BMA10229_0331     CDS       T00471                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bml00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BMA10229_0331
Enzymes [BR:bml01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     BMA10229_0331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:332168..332800
Genome map
AA seq 210 aa AA seqDB search
MHQTGNERACGAHDQPHAEIRRVRRFDPIAFEAAVRALLEASGIEIDSAHTGRTAQRVRE
LWQRRLLDGYEVDPAQALGAGFDDPREDMVIVRSIAVHGVCPHHLLPFRGVAHVAYLPGG
RLHGFGRIARMIDAISHRYTYQEWITHRIATALVTHGQARGAACLIEAEQLCLLMGENRR
GDERVITQCYAGEFERDVQARNEFLRGIHR
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaaacgggaaacgagcgcgcgtgcggcgcgcacgatcaaccgcatgcggaaatc
cggcgcgtgcgccggttcgatcccatcgcattcgaggcggcggttcgcgcgctgctcgag
gcgagcggcatcgagatcgacagcgcgcacaccggccgcactgcgcagcgtgtgcgcgag
ctctggcagcggcgtttgctcgacggctacgaagtcgatccggctcaggcgctgggcgcg
ggcttcgacgatccgcgcgaggacatggtgatcgtccgcagcatcgccgtgcacggcgtg
tgcccgcatcatttgctgccgtttcgcggcgtcgcccatgtggcgtatctgccgggcggg
cgcttgcacggcttcggacgcatcgcgcgcatgatcgacgcgatcagccatcgctatacg
tatcaggagtggatcacgcaccggatcgcgacggcgctcgtgacgcatggtcaggcgcgc
ggcgcggcgtgcctgatcgaggccgagcagctgtgcctgttgatgggcgagaaccggcga
ggcgacgagcgtgtgatcacgcagtgctacgccggcgaattcgagcgcgacgttcaggcc
cgcaacgagtttcttcgcggcatccaccgttag

DBGET integrated database retrieval system