KEGG   Burkholderia mallei NCTC 10229: BMA10229_0857Help
Entry
BMA10229_0857     CDS       T00471                                 

Definition
di-heme cytochrome c peroxidase family protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bml  Burkholderia mallei NCTC 10229
Brite
Enzymes [BR:bml01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     BMA10229_0857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:895748..897358
Genome map
AA seq 536 aa AA seqDB search
MRRARSARRRPHATRARYITDARPAGARNAGRHSGATHAGFFFCMITTERSSMAEPLCAQ
PAPSTRSDACTPAALATVSRRRGRRNACAMRHAPAAAAFGALGFAAFALAFPEHVPNAVG
AIVENLTGANPQPVALRRPGAEPLSAVAQLGRALFFDPALSASGRQSCASCHSPDHAYGP
PNDLDVQLGGAALTQPGYRPPPSLMYLYRQPNFSIGPDSSENDDAASVAQQAASAAGAVR
ARKSAGAAAAPQLVPQGGMFWDGRADTLQQQAFGPLMNPVEMANASTGDVARKLAHARYA
PRFRQLFGPRIFDDARLAVSEAMFAIARYQVEDPSFHPYSSKYDRWLEGDARLTQAELRG
MRRFNDPNKANCAGCHLSKPSADGLPPMFTDFQYEALGVPRNRALAQNRNPAFHDLGICG
PFRDNLKTQTQYCAMFATPSLRNVATRRVFFHNGVYHSLDRVLAFYNLRSVDPGKIYPRD
ASGRVLQYDDIPSAYRANVDVADAPFDRKPGDAPAMTEQDMRDIVAFLNTLTDEKR
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgcgcacgctcggcgcggcgccgcccgcacgcgacgcgcgcccgatacatcacc
gatgcacggccggccggcgcacgcaacgccggccgtcattccggcgcgacgcacgccgga
tttttcttttgcatgatcacgaccgaacgctccagcatggccgaaccgctttgcgcgcaa
cccgctccgtccacccgatccgacgcatgcacgccggccgcgcttgccaccgtctcgcgc
cgccgcggccgccgcaacgcgtgcgcgatgcgccacgcgccggcggccgccgcgttcggc
gcgctcggcttcgccgcgttcgcgctggcgtttcccgagcacgtgccgaacgcggtcggc
gcgatcgtcgaaaacctcacgggcgcgaatccgcagccggtcgcgctgcgccgcccgggc
gccgagccgctgagcgcggtcgcgcagctcggccgcgcgctgttcttcgatcccgcgctg
tccgcgtcgggccggcaatcgtgtgcgtcgtgccacagccccgatcatgcgtacggcccg
ccgaacgatctggacgtgcaactgggcggcgccgcgctgacgcagcccggctatcggccg
ccgccgtcgctgatgtatctgtaccggcagccgaacttcagcatcggcccggactcgtcc
gagaacgacgacgcggcgagcgtcgcgcaacaggccgcatccgcggcgggcgccgtgcgc
gcgcggaagagcgccggcgcggcggccgcgccgcagctcgtgccgcagggcgggatgttc
tgggacggccgcgcggatacgctgcagcagcaggcgttcggcccgttgatgaatccggtc
gagatggcgaacgcgagcaccggcgacgtcgcgcgcaagctcgcgcacgcgcgctacgcg
ccgcggttccggcagttgttcggcccgcgcatcttcgacgacgcacgtcttgcggtgtcc
gaagcgatgttcgcgatcgcgcgctaccaggtggaggacccgtcgttccatccgtattcg
agcaagtacgaccgctggctcgaaggcgacgcgcggctcacgcaggcggagctgcgcggc
atgcggcgcttcaacgatccgaacaaggcgaattgcgcgggctgccacctgtcgaagccg
agcgcggacggtctgccgccgatgttcaccgatttccagtacgaggcgctcggcgtgccg
cgcaaccgcgcgctcgcgcagaaccgcaatccggcgttccacgatctcggcatctgcggg
ccgtttcgcgacaacttgaagacgcagacgcaatactgcgcgatgttcgcgacgccttcg
ctgcgcaacgtcgcgacgcgccgcgtgttcttccacaacggcgtctatcattcgctcgac
cgggtgctcgcgttctacaacctgcgcagcgtcgatccgggcaagatctatccgcgcgac
gcaagcggccgggtgctgcaatacgacgacatcccgagcgcgtatcgcgcgaacgtcgac
gtcgccgatgcgccgttcgaccgcaagccgggcgacgcgcccgcgatgaccgagcaggac
atgcgcgacatcgttgcgtttctgaacacgctgaccgacgagaagcgctga

DBGET integrated database retrieval system