KEGG   Burkholderia mallei NCTC 10229: BMA10229_0930Help
Entry
BMA10229_0930     CDS       T00471                                 

Definition
(GenBank) putative enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
bml00071  Fatty acid degradation
bml00280  Valine, leucine and isoleucine degradation
bml00281  Geraniol degradation
bml00310  Lysine degradation
bml00360  Phenylalanine metabolism
bml00362  Benzoate degradation
bml00380  Tryptophan metabolism
bml00410  beta-Alanine metabolism
bml00627  Aminobenzoate degradation
bml00640  Propanoate metabolism
bml00650  Butanoate metabolism
bml00903  Limonene and pinene degradation
bml00930  Caprolactam degradation
bml01100  Metabolic pathways
bml01110  Biosynthesis of secondary metabolites
bml01120  Microbial metabolism in diverse environments
bml01130  Biosynthesis of antibiotics
bml01212  Fatty acid metabolism
Module
bml_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bml00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BMA10229_0930
   00650 Butanoate metabolism
    BMA10229_0930
  Lipid metabolism
   00071 Fatty acid degradation
    BMA10229_0930
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BMA10229_0930
   00310 Lysine degradation
    BMA10229_0930
   00360 Phenylalanine metabolism
    BMA10229_0930
   00380 Tryptophan metabolism
    BMA10229_0930
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BMA10229_0930
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BMA10229_0930
   00281 Geraniol degradation
    BMA10229_0930
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BMA10229_0930
   00627 Aminobenzoate degradation
    BMA10229_0930
   00930 Caprolactam degradation
    BMA10229_0930
Enzymes [BR:bml01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BMA10229_0930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABM98716
UniProt: A2RYH0
Position
II:complement(973591..974367)
Genome map
AA seq 258 aa AA seqDB search
MAYENILVETRGRVGLITLNRPKALNALNDALMDELGLALKAFDADEGIGAIVLTGSEKA
FAAGADIGMMATYSYMDVFKGDYITRNWETVRQIRKPIIAAVAGFALGGGCELAMMCDII
FAADTAKFGQPEIKLGVLPGAGGTQRLPRAVSKAKAMDMCLTARFMDAEEAERAGLVSRI
LPADKLLDEAIAAATTIAEFSLPAVMMVKEAVNRAYETTLSEGVHFERRLFHSAFATEDQ
KEGMAAFVEKRKPVFKHR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgagaacattctggtggagacgcggggcagggtggggctgattacgctgaac
cgtccgaaggcgctgaatgcgttgaatgacgccctgatggatgaacttggcttggcgctc
aaagcgttcgacgcggacgagggtattggcgcgatcgtgctgacgggcagcgagaaggcg
ttcgcggcgggcgccgacatcgggatgatggcgacctattcatacatggacgtcttcaag
ggcgactacatcacgcgtaactgggagacggtgcgccagatccgcaagccgatcatcgcg
gcggtggcgggtttcgcgctgggcggcggctgcgaactcgcgatgatgtgcgacatcatc
tttgcggccgatacggcgaagttcggccagccggaaatcaagctcggcgtgctgccgggt
gcgggcggcacgcagcgcctgccgcgcgcggtgtcgaaggcgaaagcgatggacatgtgc
ttgaccgcgcgcttcatggacgcggaggaggctgagcgggcgggcttggtgtcgaggatc
ctgccggcggacaagttgctcgacgaggcgatcgccgcggcgacgacgatcgcggaattc
tcgctgcctgccgtaatgatggtgaaggaggcggtgaatcgcgcatacgagacgaccttg
tccgaaggggtgcacttcgagcgtcgcttgtttcactcggcatttgcgactgaagatcag
aaggaagggatggcggcgttcgtcgagaagcgcaagcccgtcttcaagcatcgctga

DBGET integrated database retrieval system