KEGG   Burkholderia mallei NCTC 10229: BMA10229_0948Help
Entry
BMA10229_0948     CDS       T00471                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
bml  Burkholderia mallei NCTC 10229
Brite
Enzymes [BR:bml01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     BMA10229_0948
Secretion system [BR:bml02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   BMA10229_0948
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(992510..993238)
Genome map
AA seq 242 aa AA seqDB search
MKKTIRIAALALAAATATLGCTAQADQSTDKLKAALQSRLGADAPIKSVTKSPIAGLYEV
NLGSQIVYSDASGDYVLLGELVNTKTHKNLTAERLAEINKIDFASLPLSNAIKVVKGNGA
RKIAVFSDPNCPYCKKLETTLQSVDNVTVYTFLYPVLSPDSTVKSKSIWCASDRVKSWQS
WMLEHRAPTSAANCDTTALDKNLALGRGMNVTGTPTVFLADGTRLPGAVSADELNQALAG
VK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacgattcgtatcgccgcgctcgccctggctgccgcgacggcgacgctcggc
tgcaccgcgcaggccgaccagtccaccgacaagctgaaggccgcgctgcaatcgcgcctc
ggcgccgacgcgccgatcaagagcgtgacgaagtcgccgattgcgggtttgtacgaggtc
aatctcggctcgcagatcgtctatagcgacgcatcgggcgattacgtgctgctcggcgag
ctcgtcaacacgaagacgcacaagaacctcacggccgagcgcctcgccgagatcaacaag
atcgatttcgcgagcctgccgctgtcgaacgcgatcaaggtcgtgaagggcaacggcgcg
cgcaagatcgcggtgttctccgatccgaactgcccgtactgcaagaagctcgagacgacg
ctgcaatcggtcgacaacgtgaccgtctacacgttcctgtatccggtgctgtcgcccgat
tcgacggtgaagtcgaagtcgatctggtgcgcgagcgaccgcgtgaagagctggcagtcg
tggatgctcgagcatcgcgcgcccacgagcgcggcgaactgcgacacgaccgcgctcgac
aagaacctcgcgctcggccgcggaatgaacgtgacgggcacgccgaccgtattcctcgcc
gacggcacgcgcctgccgggcgccgtatccgccgacgaactgaatcaggcgctcgccggc
gtcaagtga

DBGET integrated database retrieval system