KEGG   Burkholderia mallei NCTC 10229: BMA10229_1222Help
Entry
BMA10229_1222     CDS       T00471                                 

Gene name
asnB-2
Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bml00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1278937..1280805)
Genome map
AA seq 622 aa AA seqDB search
MCGITGWIDFARDLRNEAPIVDTMTDTLARRGPDARGVWLDTHAALGHRRLSIIDPERGA
QPMLTPERGPRGLPRAVISYAGETYNFRELRAELGALGHRFDTHCDTEVVLRAYLEWGAA
FVDRLNGMYSIAIWDTARDELLLVRDRLGVKPLFYYPTADGVIFGSEPKAILAHPDVRAR
TSSEGLCDALLFLRTPGQVPFSGMREVKPGHVLRVRRGGLAEQRYWALEARPHTDDLPTT
IATIRALLDDIVSRQMISDVPLCALLSGGVDSSTIAALAQKRRRANGGGALSTFCVDFTG
HTRNFRADPIRPTADAPFALEVARHIGSDHHTIELDQAGLLDPQVREAVLRAWDLPFNFA
DLDVSLHRLFAEVRKHATVALSGEAADEIFGGYLWFSDPAARRAHTFPWLKLGAHRGLDP
RALFHRSFIDALRLGEYEAQLYRAALAEVPRLDGENAEDRRTRELHYLTLTRWLPVLLDK
KDRMGMASGLEGRVPFCDHRLVEYVFNIPWAMKTFSGQEKALLRAAAADLLPESVLNRKK
AAYPSIQAPGYDRGLIERLNRAIAAGRAPLEPFIDAGALRGLTEKTAAGSLSEFERILLE
SSSRLNDWLDLYRVELDGVPAG
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatcaccggatggatcgatttcgcccgcgatctgcgcaacgaagcgccgatc
gtcgacacgatgaccgatacgctcgcgcgccgcgggcccgatgcgcgcggcgtgtggctc
gacacgcacgccgcgctggggcaccggcggctgtcgatcatcgatcccgagcgcggcgcg
cagccgatgctcacgcccgagcgcgggccgcgcggcctgccgcgcgcggtcatctcgtat
gcgggcgaaacctacaacttccgcgaattgcgggccgagctgggcgcgctcggccaccgg
ttcgacacgcattgcgataccgaggtggtgctgcgcgcgtatctcgaatggggcgcggcg
ttcgtcgaccgtctcaacgggatgtattcgatcgcgatctgggataccgcgcgcgacgaa
ctgctgctcgtgcgcgaccggctcggcgtgaagccgctgttctactatccgacggcggac
ggcgtgatcttcggctcggagccgaaggcgatcctcgcgcatcccgacgtgcgcgcgcgc
acgtcgtcggaggggctttgcgatgcgctgctgttcctgcgcacgccggggcaggtgccg
ttctcggggatgcgcgaggtgaagcccggccatgtgctgcgcgtgcggcgcggcggcctc
gccgagcaacgctactgggcgctcgaagcgcgcccgcacaccgacgatctgccgacgacg
atcgcgacgatccgcgcgctgctcgacgacatcgtgtcgcgccagatgatctcggacgtg
ccgctgtgcgcgctgctgtcgggcggcgtcgattcgagcaccatcgccgcgctcgcgcag
aagcggcggcgcgcgaacggcggcggcgcgttgtcgacattctgcgtcgatttcaccggc
cacacgcgcaactttcgcgccgatccgattcgcccgacggccgatgcgccgttcgcgctc
gaagtcgcgcggcacatcggcagcgatcaccatacgatcgagctggaccaggccgggctg
ctcgatccgcaggtgcgcgaagcggtgctgcgcgcgtgggacttgccgttcaacttcgcc
gatctcgacgtgtcgctgcaccggctgttcgccgaggtccgcaagcacgccaccgtcgcg
ctatccggcgaggcggccgacgagatcttcggcggctacctgtggttctccgatccggcc
gcgcggcgtgcacacacgttcccgtggctgaagctgggcgcgcatcgcgggctcgatccg
cgcgcgctgtttcatcggtcgttcatcgatgcgctgcgactcggcgaatacgaagcacag
ctctaccgcgcggcgctcgccgaagtgccgcgcctcgacggcgagaacgcggaggaccgc
cgcacgcgcgagctgcattacctgacgctcacgcgctggctgccggtgctgctcgacaag
aaggaccggatggggatggcaagcggcctcgaggggcgcgtgccgttctgcgatcaccgg
ctcgtcgagtatgtgttcaacatcccgtgggcgatgaagacgttcagcggccaggagaag
gcgctgctgcgcgcggcggcggccgatctgctgcccgaatcggtgctgaaccgcaagaag
gccgcgtatccgtcgattcaggcgccgggctatgaccgcggcctgatcgagcgcctcaat
cgcgcgatcgcggccggccgcgcgccgctcgaaccgttcatcgacgccggcgcgctgcgc
ggcctgaccgagaagaccgccgccggcagcctttcggaattcgaacgaatcctgctggag
tcgagcagccggctcaacgactggctcgatctctatcgtgtcgagctcgacggcgtgccg
gcgggctga

DBGET integrated database retrieval system