KEGG   Burkholderia mallei NCTC 10229: BMA10229_1222Help
Entry
BMA10229_1222     CDS       T00471                                 

Gene name
pvcC
Definition
(GenBank) pyoverdin chromophore biosynthetic protein PvcC
Organism
bml  Burkholderia mallei NCTC 10229
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
II:complement(1280851..1282335)
Genome map
AA seq 494 aa AA seqDB search
MTLMTGNDYLDSLRDGRNVYVGGERIADVASHRAFRNAARSIASLYDALHGEHRERLTAP
DRHGQITHRFFKPSESPDDLLAAQDAIELWSRMTYGFMGRTPDYKAAFMSGLEAGADYYG
DFRQNAAGWYKRFAGSGLYLNHAIINPPLDRGKAIHDMRDVFVRVVGETDRGIVVSGVKM
LATAGALTNATFVAPVASALLEPGKADDFAIVFFARMDNPGLSLMCRPSYEAAATSPFDA
PLSSRFDENDSVLIFDRALIPWEDVLVYRDVKRATGFYAASGFANLYNFQSGIRLAVKLE
LMIGLLSLGTQANGTQSFRGIQAALGELISLQHLLKTITAAMARDPERTPSGVVVPKLQY
ASALRIQVPQIWKRVRELMETALGGSPLVTVSGAADLLDPRVKGLIDAYYRGAALEPQQR
IKLFKLIWDATGSEFGSRHSVYETHYSGNFDQIRLDSLTWATRSGQLAGCEAFARQCMGD
YDASGWLRGPWLHG
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacgttgatgacgggaaacgactatctcgacagcctgcgtgacgggcgcaacgtgtat
gtcggcggcgagcggatcgccgatgtcgcgtcgcaccgcgcgtttcgcaacgcggcgcgc
agcatcgcttcgctgtacgacgcattgcacggcgagcatcgcgagcggctgaccgcgccc
gaccggcacgggcagatcacgcaccgcttcttcaagccgagcgaatcgcccgacgatctg
cttgccgcgcaggatgcgatcgagctgtggtcgcggatgacttacggcttcatgggccgc
acgcccgattataaggccgcgttcatgtcggggctcgaggcgggcgccgactattacggc
gatttccggcaaaacgcggccggctggtacaagcgcttcgcgggcagcggcctgtatctg
aatcacgcgatcatcaatccgccgctcgatcgcggcaaggcgattcatgacatgcgcgac
gtgttcgtgcgcgtcgtcggcgagaccgatcgcgggatcgtcgtgagcggcgtgaagatg
ctcgcgacggcgggcgcgctcaccaacgcgacgttcgtcgcgccggtcgcctcggcgctg
ctggagcccggcaaggccgacgatttcgcgatcgtgttcttcgcgcggatggacaacccg
gggttgagcctgatgtgccggccgtcgtacgaagcggccgcgacgagcccgttcgacgcg
ccgctgtcgagccgtttcgacgagaacgacagcgtgctgatcttcgatcgcgcgctgatt
ccatgggaagacgtgctcgtctatcgcgacgtgaagcgcgcgaccggcttctacgcggcg
tcgggtttcgcgaatctctacaacttccagtcgggcatccggctcgcggtgaagctcgag
ctgatgatcggcctgctgtcgctcggcacgcaggcgaacggcacgcaatcgttccgcggc
attcaggcggcgctcggcgagctgatctcgctccagcatctgctgaagacgatcacggcc
gcgatggcgcgcgatcccgagcgcacgccgagcggcgtcgtcgtgccgaagcttcagtat
gcgagcgcgctgcggatccaggtgccgcagatctggaagcgcgtgcgcgagctgatggag
accgcgctcggcggctcgccgctcgtcaccgtctcgggcgcggccgatctgctcgatccg
cgggtgaagggcctgatcgacgcgtactaccgcggcgcggcgctcgagccgcagcagcgg
atcaagctcttcaagctgatctgggatgcgaccggcagcgagttcggctcgcgtcattcg
gtctacgaaacgcattattccggcaacttcgaccagatccggctcgattcgctgacatgg
gcgacccgctccggccagcttgccggctgcgaggcgttcgcgcggcagtgcatgggcgac
tacgacgcgtcgggctggctgcgcggcccctggctgcacggctga

DBGET integrated database retrieval system