KEGG   Burkholderia mallei NCTC 10229: BMA10229_1263Help
Entry
BMA10229_1263     CDS       T00471                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bml  Burkholderia mallei NCTC 10229
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
II:1319596..1321038
Genome map
AA seq 480 aa AA seqDB search
MNLNDQIDTLDSRFDQLIRTVCEVASAARHTAATAAADKTAAQAAFEAAAEKHTQAASMS
VEQATLEALAAQAAADKEAADALARQAAAVQAAAEAAAAQAVTDKTAAEALAMQAAAERA
AAERAAAQAAEDKAAAEALAAQAAADRTAAEHAATQAAADKAAAESLVAQAAAERATAEH
AVTQAAAERAASEQAAARAAAEKTAAETLAAQAAAERAAAEHAAEQAAADKAQAQALAQQ
AAADRAAAEQAEADRAAAQHAAAQAATDRAAAEARATEQAADAKAAAESLAAQAAADRAA
AEQAAAQATADKDAAESLFKQAAAERSAAEAAAARAASYKATAEALAAQAERNRAMIEAE
PAAPVATAQTANGTLSLHVARPSQDEISLALGEHSVSLPPHQLSQLIEELAHARASMTIE
QPSGLPNGWRFVTTRNPLMAVQKQANGDRLLVARHSGYGWVPFTFSPDVVIQLYMLLTQK
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgaacgatcagatcgatacgctcgacagccgcttcgatcagctcatccgcacg
gtgtgcgaagtcgcgagcgctgctcggcacaccgccgcaaccgccgccgcggacaagacc
gccgcgcaggccgccttcgaagcagccgccgagaaacacacgcaagccgccagcatgtcc
gtcgagcaagcgacgctcgaagccctcgccgcccaggcggccgccgacaaggaagccgcc
gacgcgctcgccaggcaggccgcagccgtccaggccgcggccgaagcggccgccgcgcag
gcggtcaccgacaagaccgcggccgaagcgctcgcgatgcaggcggcggcggagcgcgcc
gccgccgagcgagcggcggcgcaagcggccgaagacaaagccgccgccgaggcgctcgcc
gcgcaggcggcggcggatcgcactgccgccgaacacgcggcaacgcaggcggcggcggac
aaagccgcggccgaatcgctcgtcgcccaagcagcggcggagcgcgcgaccgccgagcac
gcggtgacccaggcggcggcggagcgcgccgcatccgagcaggcggcggctcgagcggcg
gccgagaagaccgcggccgagacgctcgccgcgcaagcggccgccgagcgcgccgcggcc
gaacacgcggccgagcaggccgccgccgacaaggcgcaagcgcaagcgctcgcgcaacag
gccgccgccgatcgggcggcggcggagcaagccgaggccgatcgcgccgccgcgcaacac
gccgccgcccaggcggcgacggaccgcgcggctgccgaggcgcgcgcgaccgagcaagcc
gccgacgccaaggccgcggccgaatcgctcgccgcgcaggccgccgccgatcgcgccgcc
gcggagcaggccgccgctcaggcgacggccgacaaggatgcggccgagtcgctgttcaag
caggccgcggccgagcgctcggccgccgaggccgccgccgcgcgcgcggcgagctacaag
gcaacagcggaggcgctcgccgcgcaggccgagcgcaaccgggcgatgatcgaggccgag
cccgccgcgcccgtggcgacggcgcaaaccgcgaacggcacgctttcgctgcacgtcgca
cggccgtcgcaggacgagatctcgctcgcgctcggcgagcattcggtgtcgctgccgccg
caccagctcagccagttgatcgaggaactggcgcacgcgcgggcatcgatgacgatcgag
cagccgagcggattgccgaacggctggcgcttcgtgacgacacgcaacccgctgatggcg
gtccagaagcaggcgaacggcgatcgtctgctggtcgcgcggcacagcggctatggctgg
gtaccgttcacgttctcgccggatgtcgtgattcagctgtacatgctgctcacgcagaag
tga

DBGET integrated database retrieval system