KEGG   Burkholderia mallei NCTC 10229: BMA10229_1332Help
Entry
BMA10229_1332     CDS       T00471                                 

Definition
(GenBank) pyridine nucleotide-disulphide oxidoreductase family protein
Organism
bml  Burkholderia mallei NCTC 10229
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
II:complement(1382456..1384729)
Genome map
AA seq 757 aa AA seqDB search
MREFDYLLVGGGIASVTAARTLRGEDASASIAILCGEPVLPYQRPPLSQEWLMGAVQPAS
ITLHDAAFYAAQRIDIALGVRAEQLDRAKRIVRTSSGATFRYGKLLIATGASAKAPALPG
FGLDGVHVLHTFAQAQALKDAAAHARRATVLGGGFLGVEIAATLQALGLQVTLVERAPGV
MPSLRAPALGGHFEALCRARGIDVLTRCEVRRVLGAQCVEAVETSDGGTRPCDLFVAAVG
VTPNCGWLDGSGLALGDGVEVDAFLQTADPDVFAAGDVAHFDDPIFGVRRRIEHWDNAVR
QGRIAARNMLGHRLPYRDVSIFYGSVFGLSYNLLGYPVGATETIERGAFDEASYMQLYLA
DDVLRAAFTIDRPAVEIAALNDAIRLHVNVAAHKMKLSDPNYPLDKLPVQTILILQGGGA
LGAFECGAVKALEQHGVRPDVISAVSIGAFNGAIVASHPKGATKALEAFWRELSIALPLP
YESQWREAWLSSYVLSFGVPNFLKPQWSQLGFDADRLRAKWTSFFDATAIEQLIARYVDF
DSLGMSPTRLLIGAVDVETGEPRIFDSYVDRLSPAHVLASGSLPPGMPWTVVDGRPYWDG
GVVSNSPLDLVIARCGQIGGRVFIVDLFSGSKALPTNLVEVMLRREEIAYMDRVRNDLRF
EEYASDFRDLVDGILAHVDAPSANEIRQQPLYIRLMGNRAAIDIARITLNREGRLSFIED
YDFSSDAIAQLQQQGYDAALVALANGRSRRRRGRRRA
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgagttcgactatctgctcgtgggcggcggcatcgcgagcgtcacggcggcgcgg
acgctgcgcggcgaggatgcgtcggcgagcatcgcgatcctctgcggcgagccggtgctg
ccgtatcagcgcccgccgctcagccaggagtggctgatgggggccgtgcagcccgcgagc
atcacgctgcacgacgcggcgttctacgcggcgcaacgcatcgacatcgcgctcggcgtg
cgcgccgagcagctcgatcgcgcgaagcggatcgtgcgcacgtcgagcggcgcgaccttt
cgctacggcaagctgctgatcgcgacgggcgcgagcgcgaaggcgccggcgctgcccggc
ttcgggctcgacggcgtgcacgtgctgcacacgttcgcgcaggcgcaggcgctgaaggac
gcggccgcgcacgcgcgccgcgcgacggtgctgggcggcggctttctcggcgtcgagatc
gccgcgacgctgcaggcgctcggcctgcaggtgacactcgtcgagcgcgcgcccggcgtg
atgccgtcgctgcgcgcgccggcgctcggcggccatttcgaagcgctttgccgcgcgcgc
ggcatcgatgtgctcacgcgctgcgaggtgcgccgcgtgctcggcgcgcagtgcgtcgag
gcggtcgagacgagcgacggcggcacgcggccgtgcgatctgttcgtggcggcggtgggc
gtcacgccgaactgcggttggctcgacggcagcggcctcgcgctcggcgacggggtcgaa
gtcgatgcattcctgcagacggccgacccggacgtgttcgcggcgggcgacgtcgcgcac
ttcgacgatccgatcttcggcgtgcggcggcggatcgagcactgggacaacgcggtgcgg
cagggccggatcgccgcgcgcaacatgctcggccaccggctgccgtatcgcgacgtgtcg
atcttctacggcagcgtgttcgggctgtcgtacaacctgctcggctatccggtcggcgcg
accgagacgatcgagcgcggcgcgttcgacgaagcctcgtacatgcagctctatctcgcc
gacgacgtgctgcgcgccgcgttcacgatcgaccggccggccgtcgagatcgccgcgctg
aacgacgcgatccggctgcacgtgaacgtcgccgcgcacaagatgaaactgagcgatccg
aactatccgctcgacaagctgccggtgcagacgatcctgatcctgcagggcggcggcgcg
ctcggcgcgttcgagtgcggcgcggtcaaggcgctcgagcagcacggcgtgcgccccgac
gtgatctccgcggtgtcgatcggcgcgttcaacggcgcgatcgtcgcgagccatccgaag
ggcgcgacgaaggcgctcgaggcgttctggcgcgagctgtcgatcgcgctgccgctgccg
tacgaatcgcagtggcgcgaggcgtggctatcgtcgtacgtgctgtcgttcggcgtgccg
aatttcctgaagccgcaatggtcgcagctcggtttcgacgccgatcggctgcgcgcgaaa
tggacgagcttcttcgacgcgacggcgatcgagcaactgatcgcgcgctacgtcgatttc
gactcgctcggcatgagcccgacgcgcctgctgatcggcgcggtcgacgtcgagacgggc
gagccgcgcatcttcgacagctacgtcgatcgcctgagccccgcgcatgtgctcgcgagc
ggcagcctgccgccgggcatgccgtggaccgtcgtcgacggccgcccgtactgggacggc
ggcgtcgtcagcaactcgccgctcgacctcgtgatcgcgcgatgcgggcagatcggcgga
cgcgtgttcatcgtcgatctgttctccggctcgaaggcgctgccgacgaacctcgtcgag
gtgatgctgcgccgcgaggaaatcgcgtacatggaccgcgtgcgcaacgatctgcgcttc
gaggaatacgcgagcgattttcgcgacctcgtggacggcatcctcgcgcacgtcgacgcg
ccgagcgcgaacgaaatccgtcagcagccgctgtacatccggctgatgggcaatcgcgcg
gcgatcgacatcgcgcggatcacgctgaaccgggaagggcggctgtcgttcatcgaggac
tacgatttttcgtcggacgcgatcgcgcaactgcagcagcagggctacgacgcggcgctc
gtcgcgctcgcgaatggccgctcgcggcgccggcgcgggcggcgccgcgcgtga

DBGET integrated database retrieval system