KEGG   Burkholderia mallei NCTC 10229: BMA10229_1332Help
Entry
BMA10229_1332     CDS       T00471                                 

Definition
cholesterol oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
bml  Burkholderia mallei NCTC 10229
Brite
KEGG Orthology (KO) [BR:bml00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    BMA10229_1332
Enzymes [BR:bml01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     BMA10229_1332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:1380247..1382145
Genome map
AA seq 632 aa AA seqDB search
MLGATRSTLWGSRERPRIAAARAPGAAAIRMREEARECAGPRGAGRAPHRATAAGGKTGR
RTVRAPSRARAGSNNQKVNRMKQQSYDYDYVVVGSGFGGSVSALRLSEKGYRVLVIEQGR
RWTPENLPESTWNLSRWQWRPALGLHGFFSMRFFRHVVVLHGNAVGGGSITYANTLLVPP
NKVWREGTWAGLEDWERVMPAHYATAKRMLGVVTNRRMDAADFRLKDMAKLIGVEKSFYP
TEVGVFFGDDADAPGTRYADPYFGGAGPERTSCIGCGGCMVGCRHGAKNTLDRNYLYLAE
RLGAQVREQTKVVDVRPLDARADGAAGYAVEAVSLAAGARGAKSRLTCRGVVFAASSLGT
QDLLMRLKEKGSLPRLSDALGKRVRTNAESLIGVRFPKSRVDLSKGVAIGSGIYIDEHTH
IEATRYPSGSDTMGLLTTVLTRGAPGGLRVLVWLGALAKLVLTRPLSAWRMIDPRGFARE
TMIFLCMQTLEGHLTMRLKRRWFWPFSKQLATSGAKIPAYIPAANDFAQKAARALGGVPM
TSLTEILLNVPMTAHCMGGAAMARDARDGVCDGRSRVFGYRNMYVCDGSVLGANLGVNPS
LTITALAEHAMSHVPAAREQRWDSTAETPVAA
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgctcggcgcaacgcgctcgacactatggggttctcgtgagcggccgcggatcgcggcg
gcgcgcgcgccgggcgccgccgcgatccggatgcgcgaagaggcgcgggaatgcgcggga
ccacgcggcgcaggccgtgcgccgcatcgcgcaacggcggccggcgggaaaacagggaga
cgaaccgttcgtgcaccgtcgcgcgcgcgggccggttcgaacaatcaaaaggtgaaccga
atgaagcagcagtcctacgattacgactacgtcgtggtcggctccggcttcggcggcagc
gtctcggcgctgcgtctgtccgagaaaggctatcgtgtgctcgtgatcgagcagggccgt
cgctggacgcccgagaacctgccggaaagcacgtggaacctgtcgcgctggcaatggcgc
cccgcgctcgggctgcacggcttcttcagcatgcgctttttcaggcacgtcgtcgtgctg
cacggcaatgcggtgggcggcggctcgatcacgtacgcgaacacgctgctcgtgccgccc
aacaaggtctggcgcgagggcacatgggccggcctcgaggactgggaacgcgtgatgccc
gcgcactacgccaccgcgaagcgcatgctcggcgtcgtcacgaaccggcgaatggatgcg
gccgacttccggctgaaggacatggcgaagctgatcggcgtcgagaagagcttctatccg
accgaggtcggcgtgttcttcggcgacgacgccgacgcgcccggcacgcgctacgccgat
ccgtacttcggcggcgcgggcccggagcgcacgtcgtgcatcggctgcggcggctgcatg
gtcggctgccgccacggcgcgaagaacacgctcgaccgcaattacctgtatctcgccgag
cgcctcggcgcgcaggtgcgcgagcagacgaaggtcgtcgacgtgcgcccgctcgacgcg
cgcgccgacggcgcggcgggctacgcggtcgaagcggtgtcgctcgcggcgggcgcgcgc
ggcgcgaaaagccgcctcacgtgccgcggcgtcgtgttcgccgcatcctcgctcggcacg
caggatctgctgatgcgcctgaaggaaaagggctcgctgccccggctatcggacgcgctc
ggcaagcgcgtgcgcacgaacgccgaatcgctgatcggcgtgcgctttccgaaatcgcgc
gtcgatctgtcgaagggcgtggcgatcggctcgggcatctacatcgacgagcacacgcac
atcgaggccacccgctatccttcgggctccgacacgatggggctgctcacgaccgtgctc
acgcgcggcgcgccgggcggtttgcgtgtgctcgtgtggctcggcgcgctcgcgaagctc
gttctcacgcgaccgctgagcgcgtggcggatgatcgacccgcgcggcttcgcgcgcgag
acgatgatcttcctctgcatgcagacgctcgaaggacacctgacgatgcgcctgaagcgc
cgctggttctggccgttctcgaagcagctcgcgacctccggcgcgaagatccccgcctac
attccggccgcgaacgacttcgcgcagaaggccgcgcgcgcgctcggcggcgtgccgatg
acctcgctcaccgagatcctgctgaacgtgccgatgaccgcgcattgcatgggcggcgcg
gcgatggcgcgcgacgcgcgcgacggcgtgtgcgacggccgcagccgcgtgttcggctat
cggaacatgtacgtctgcgacggctcggtgctcggcgcgaacctcggcgtcaacccgagc
ctcacgatcacggcgctcgccgagcatgcgatgagccacgtgcccgccgcgcgcgagcag
cggtgggacagtaccgcggagacgcctgtcgcggcatga

DBGET integrated database retrieval system