KEGG   Burkholderia mallei NCTC 10229: BMA10229_1447Help
Entry
BMA10229_1447     CDS       T00471                                 

Gene name
adc
Definition
(GenBank) acetoacetate decarboxylase (EC:4.1.1.4)
  KO
K01574  
acetoacetate decarboxylase [EC:4.1.1.4]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
Synthesis and degradation of ketone bodies
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bml00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BMA10229_1447 (adc)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    BMA10229_1447 (adc)
Enzymes [BR:bml01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.4  acetoacetate decarboxylase
     BMA10229_1447 (adc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
II:complement(1513476..1514216)
Genome map
AA seq 246 aa AA seqDB search
MKPSQVRSKAFAMPLTSPAFPMGPYRFVNREFLIITYRTDMDRLREIVPEPLEVKEPLVH
YEFIRMPDSTGFGDYTESGQVIPVEYKGQPGGYTLAMYLNDHPPIAGGRELWGFPKKLAQ
PTLQTHIDTLLGTLDYGPVRVATGTMGYKHQELDLEEQAKRLAGANFLLKIIPHVDGSAR
VCELVRYYLQDIEMKGAWTGPASLQLAPHALAPVADLPVLEIVEARHLLADLTLGLGEVV
YDYLAQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccagccaagtccgatcgaaagcattcgcgatgccgctcacgagcccggcattc
ccgatgggcccttaccgtttcgtcaatcgggaattcctgatcatcacgtatcgcaccgac
atggatcgcctgcgcgaaatcgtgccggagccgctcgaggtcaaggaaccactcgttcat
tacgaattcattcgcatgcccgattcgaccggcttcggcgattacaccgagagcggccag
gtgatccccgtcgaatacaagggccagcccggcggctatacgctcgcgatgtatctgaac
gatcacccgccgatcgcgggcggccgcgaattgtggggattcccgaagaaactcgcgcag
ccgacgctgcagacgcacatcgatacgctgctcggcacgctcgactacggccccgtgcgc
gtcgcgacgggcacgatgggctacaagcaccaggagctcgatctcgaagagcaggcaaag
cgcctcgccggcgcgaacttcctgctgaagatcatcccgcacgtcgacggctcggcgcgc
gtgtgcgagctcgtgcgctattacctgcaggacatcgagatgaagggcgcgtggacgggc
cccgcgtcgctgcagctcgcgccgcatgcgctcgcgcccgtcgccgatctgccggtgctc
gagatcgtggaggcgcggcacctgctcgccgatttgacgctcggcctcggcgaagtcgtc
tacgattacctcgcgcagtga

DBGET integrated database retrieval system