KEGG   Burkholderia mallei NCTC 10229: BMA10229_1480Help
Entry
BMA10229_1480     CDS       T00471                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
bml  Burkholderia mallei NCTC 10229
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
II:complement(1537868..1538794)
Genome map
AA seq 308 aa AA seqDB search
MMPDLDLNLIPYLVALNEARNVSRAGELLGVSQPRVSAALGRLREHFGDPLFVRTSRGME
PTPRALALIPAARDALASIERGLGAPHEFDPAKSARTFSIALSDVGEIVFLPRLLQAFAQ
HAPHANLRSASLSHAEVAHALEDGGVDLAVGYFPDLGGTNFFQQRLFTHRFICLLRRGHP
LAERPLTLERFLACGHAVVRAEGRSQEVLEQYLTKRRLTRRAVLETPHFMSLPFILSRTD
LIATVPHAIGYAYAAEHASITLVEPPLPLPRFDLKQHWHRKFHNDPSITWLRGVVAQLFN
DALDEWPK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtgatgcctgacctcgatctgaacctgattccgtatctggtcgcgctcaacgaggcgcgc
aacgtgagccgcgcgggcgagctgctcggcgtgagccagccgcgtgtgagcgcggcgctc
gggcggctgcgcgagcacttcggcgatccgctgttcgtgcggacctcgcgcggcatggag
ccgacgcctcgcgcgctcgccctgattccggccgcgcgcgacgcgctcgcgagcatcgag
cgcggtctcggcgcaccgcacgagttcgacccggcgaagagcgcgcgcacgttctcgatc
gcgctgtccgacgtcggcgaaatcgtgttcctgccgaggctgctgcaagcgttcgcgcaa
cacgcgccgcatgcgaacctgcgctcggcatcgctgtcgcacgcggaagtcgcgcacgcg
ctcgaggacggcggcgtcgatctcgcggtcggctactttccggatctcggcggcacgaac
ttcttccagcaacggcttttcacgcaccgcttcatctgcctgctgcggcgcggccacccg
ctcgccgagcggccgctcacgctcgagcggtttctcgcgtgcggccacgcggtggtgcga
gcggaaggccgcagccaggaggtgctcgagcagtatctgacgaagcggcgcctcacgcgc
cgggcggtgctcgagacaccgcatttcatgagcctgccgttcatcctgagccgcaccgac
ctgatcgcgacggtgccgcatgcgatcggctatgcatatgcggccgagcatgcgtcgatc
acgctcgtcgagccgccgctgcctttgcctcgcttcgatctgaagcagcattggcatcgc
aagttccataacgatccgagcatcacgtggctgcgcggcgtcgtcgcccagctgttcaac
gatgcgctcgacgaatggccgaagtga

DBGET integrated database retrieval system