KEGG   Burkholderia mallei NCTC 10229: BMA10229_1600Help
Entry
BMA10229_1600     CDS       T00471                                 

Gene name
dehII-1
Definition
(GenBank) haloacid dehalogenase, type II (EC:3.8.1.2)
  KO
K01560  
2-haloacid dehalogenase [EC:3.8.1.2]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
Chlorocyclohexane and chlorobenzene degradation
Chloroalkane and chloroalkene degradation
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bml00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BMA10229_1600 (dehII-1)
   00361 Chlorocyclohexane and chlorobenzene degradation
    BMA10229_1600 (dehII-1)
Enzymes [BR:bml01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     BMA10229_1600 (dehII-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
II:1651827..1652867
Genome map
AA seq 346 aa AA seqDB search
MPVCLRARALVRDEAGLYFSPGMQAGGSPIMSDGRGAFLSDVQARRSARGGSYGAVLRSS
PRRAPPAGARLAAAFGRARAFGVGPVRAADGGRCILKRHPTTQENIMQTLGVKALVFDVF
GTVVDWRSGVIRDATPFLAKYGGAGADPAAFADAWRAGYSPAMEEVRSGRRPFTRLDVLH
RENLDALLPAFGIDRASVADADLDALNLAWHRLDPWPDSVAGLTRLKAHYIIAPLSNGNV
ILMIDMAKRAGLPWDAILGAEVAQAYKPTPEAYLRTADILALRPDEVCLVAAHNGDLAAA
RRCGYRTAFVARAREHGPAQTTDLRAEQDWDVVAADFIELAQRFGA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgtgtgcttgcgtgcccgtgcgctcgtgcgcgatgaagccggcctctatttctcg
ccgggcatgcaggcaggcggttcgccgataatgtcggacggcagaggtgcgtttctttcg
gacgtgcaggcgcggcggtccgcgcgtggcggatcgtacggggcggtcctgcgttcgtcg
cccaggcgcgcgccgccggccggcgcgcggctcgccgcggcgttcggccgggcgcgcgcg
ttcggcgtcgggccggtgcgagccgccgacggcggccgctgcatcctgaaacgtcatccc
acgactcaggagaacatcatgcagacgcttggcgtgaaggcattggtattcgacgtgttc
ggcaccgtggtcgactggcgttccggcgtcattcgcgacgcgacgccgttcctcgcgaag
tacggcggcgcgggagccgatccggccgcgttcgcggatgcatggcgcgcgggctattcg
cccgcgatggaggaggtgcgcagcggccgccggccgttcacgcggctcgacgtgctgcac
cgggagaatctcgacgcgctgctgcccgcgttcggcatcgatcgcgcgagcgtggccgac
gccgatctcgacgcgctgaacctcgcatggcaccggctcgatccgtggcccgattcggtc
gcggggctcacgcggctgaaggcgcattacatcatcgcgccgctgtcgaacggcaacgtg
atcctgatgatcgacatggccaagcgcgcggggctgccgtgggacgcgatcctcggcgcc
gaggtggcgcaggcgtacaagccgacgcccgaagcgtacctgcgcacggccgatatcctc
gcgctgcgtccggatgaggtgtgcctcgtcgccgcgcacaacggcgacctcgcggccgcg
cggcgctgcggctatcgcaccgcgttcgtcgcgcgagcgcgcgagcatggtcccgcgcag
accaccgatctgcgcgcggagcaggattgggacgtcgtcgcggccgatttcatcgagctc
gcgcagcgcttcggcgcgtga

DBGET integrated database retrieval system