KEGG   Burkholderia mallei NCTC 10229: BMA10229_1742Help
Entry
BMA10229_1742     CDS       T00471                                 

Definition
(GenBank) hypothetical protein
  KO
K01905  
acetyl-CoA synthetase (ADP-forming) [EC:6.2.1.13]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMA10229_1742
   00620 Pyruvate metabolism
    BMA10229_1742
   00640 Propanoate metabolism
    BMA10229_1742
Enzymes [BR:bml01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.13  acetate---CoA ligase (ADP-forming)
     BMA10229_1742
Lipid biosynthesis proteins [BR:bml01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BMA10229_1742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
II:1786410..1786523
Genome map
AA seq 37 aa AA seqDB search
MRRRLGFVGCTMQAVDGSARRSPWRVVDVGGNLKSGM
NT seq 114 nt NT seq  +upstreamnt  +downstreamnt
gtgagacgccggcttggcttcgtcggttgcacgatgcaggcggtcgacggaagcgcccgg
cgatcgccgtggcgcgtggtcgatgtgggcggcaatttgaagtccggcatgtag

DBGET integrated database retrieval system