KEGG   Burkholderia mallei NCTC 10229: BMA10229_1742Help
Entry
BMA10229_1742     CDS       T00471                                 

Definition
(GenBank) hypothetical protein
Organism
bml  Burkholderia mallei NCTC 10229
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
II:1786410..1786523
Genome map
AA seq 37 aa AA seqDB search
MRRRLGFVGCTMQAVDGSARRSPWRVVDVGGNLKSGM
NT seq 114 nt NT seq  +upstreamnt  +downstreamnt
gtgagacgccggcttggcttcgtcggttgcacgatgcaggcggtcgacggaagcgcccgg
cgatcgccgtggcgcgtggtcgatgtgggcggcaatttgaagtccggcatgtag

DBGET integrated database retrieval system