KEGG   Burkholderia mallei NCTC 10229: BMA10229_1830Help
Entry
BMA10229_1830     CDS       T00471                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
bml00020  Citrate cycle (TCA cycle)
bml00190  Oxidative phosphorylation
bml00650  Butanoate metabolism
bml01100  Metabolic pathways
bml01110  Biosynthesis of secondary metabolites
bml01120  Microbial metabolism in diverse environments
bml01130  Biosynthesis of antibiotics
bml01200  Carbon metabolism
Module
bml_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bml_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bml_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bml00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMA10229_1830 (sdhA)
   00650 Butanoate metabolism
    BMA10229_1830 (sdhA)
  Energy metabolism
   00190 Oxidative phosphorylation
    BMA10229_1830 (sdhA)
Enzymes [BR:bml01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BMA10229_1830 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     BMA10229_1830 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO FAD_binding_3 Thi4 Pyr_redox_2 HI0933_like GIDA FAD_oxidored Lycopene_cycl NAD_binding_8 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ABN00094
UniProt: A2S108
Position
II:1878748..1880523
Genome map
AA seq 591 aa AA seqDB search
MAAIKTSLPRRKFDVVIVGAGGSGMRASLQLSRAGLSVCVLSKVFPTRSHTVAAQGGIGA
SLGNMSEDNWHYHFYDTIKGSDWLGDQDAIEFMCREAPNVVYELEHFGMPFDRNADGTIY
QRPFGGHTANYGEKPVQRACAAADRTGHALLHTLYQQNVAAKTQFFVEWMALDLIRDADG
DVLGVTALEMETGDVYILEGKTTLFATGGAGRIFAASTNAFINTGDGLGMAARSGIALQD
MEFWQFHPTGVAGAGVLITEGVRGEGGILRNANGERFMERYAPTLKDLAPRDFVSRSMDQ
EIKEGRGVGPNKDHVLLDLSHIGAETIMKRLPSIREIALKFANVDCIKEPIPVVPTIHYQ
MGGIPTNIHGQVVGTSRDHKEPINGFYAVGECSCVSVHGANRLGTNSLLDLVVFGRAAGN
HIVEHVKNQRDHKPLPADAADFSLSRLAKLEKSTSGEYTQDIANDIRATMQKHAGVFRTS
ALLKEGVEQMAGLKERAAAVHLKDKSKVFNTARVEALELANLIEVARATMVSAEARKESR
GAHAHSDYEHRDDENWLRHTLWYSEGDRLDYKPVQMKPLTVESVPPKARTF
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaatcaaaacttccctgccgcgtcgcaagttcgacgtggtgatcgtcggcgcg
ggcggctcggggatgcgcgcgtcgctgcaactgtcgcgcgcgggcctctccgtatgcgtg
ctctcgaaggtgttcccgacccgttcgcacacggtcgccgcgcaaggcgggatcggcgcg
tcgctcggcaacatgagcgaagacaactggcactaccacttctacgacacgatcaagggc
tccgactggctcggcgatcaggacgcgatcgagttcatgtgccgcgaggcgccgaacgtc
gtgtacgagctcgagcacttcggcatgccgttcgaccgtaacgcggacggcacgatctac
cagcgtccgttcggcggccacacggccaactacggcgagaagccggtccagcgcgcgtgc
gcggcggccgaccgtaccggccacgcgctgctgcacacgctgtatcagcaaaacgtcgcg
gcgaagacgcagttcttcgtcgaatggatggcactcgacctgatccgcgacgcggacggc
gacgtgctcggcgtgacggccctcgaaatggaaacgggcgacgtctacatcctcgaaggc
aagaccacgctgttcgccacgggcggcgcgggccggatcttcgcggcgtcgaccaacgcg
ttcatcaataccggcgacggcctcggcatggccgcgcgttcgggcatcgcgctgcaggac
atggaattctggcaattccacccgacgggcgtcgcgggcgcgggcgtgctgatcaccgaa
ggcgtgcgcggcgaaggcggcattctgcgcaacgcgaacggcgagcgcttcatggagcgc
tacgcgccgacgctgaaggatctggcgccgcgcgatttcgtgtcgcgctcgatggaccag
gaaatcaaggaaggccgcggcgtgggcccgaacaaggaccacgtgctgctcgacctgtcg
cacatcggcgccgagacgatcatgaagcgtctgccgtcgatccgcgaaatcgcgctgaag
ttcgcgaacgtcgactgcatcaaggaaccgattcccgtcgtgccgacgatccactaccag
atgggcggcatcccgaccaacatccacggccaggtggtgggcacgtcgcgcgatcacaag
gagccgatcaacggcttctatgcggtgggcgaatgctcgtgcgtgtccgtgcacggcgcg
aaccgcctcggcacgaactcgctgctcgacctcgtcgtgtttggtcgcgcggccggcaac
cacatcgtcgagcacgtgaagaaccagcgcgatcacaagccgctgccggccgacgccgcc
gacttctcgctgtcgcgcctcgcgaagctcgagaagtcgacctcgggcgagtacacgcag
gacatcgccaacgacatccgcgcgacgatgcaaaagcatgccggcgtgttccgcacgtcc
gcgctgctcaaggaaggcgtcgagcaaatggcgggcctgaaggagcgcgccgccgccgtc
cacctgaaggacaagtcgaaggtgttcaacaccgcgcgcgtcgaagcgctcgaactggcg
aacctgatcgaggtcgcgcgcgcgacgatggtgtcggcggaagcgcgcaaggaaagccgc
ggcgcgcacgcgcacagcgattacgagcaccgcgacgacgagaactggctgcgtcacacg
ctgtggtacagcgaaggcgatcgcctcgactacaagcccgtccaaatgaagccgctgacg
gtcgagtccgtgccgccgaaggcgcgtacgttctaa

DBGET integrated database retrieval system