KEGG   Burkholderia mallei NCTC 10229: BMA10229_1858Help
Entry
BMA10229_1858     CDS       T00471                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bml00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BMA10229_1858 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BMA10229_1858 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BMA10229_1858 (trpB)
Enzymes [BR:bml01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     BMA10229_1858 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:1904031..1905224
Genome map
AA seq 397 aa AA seqDB search
MYNLPDDRGHFGPYGGVFVAETLIHALDELRAAYEKFKNDPEFVAEYNRELKHFVGRPSP
IYHAQRWSETLGGAQIYLKREDLNHTGAHKVNNVIGQALLAKRMGKRRVIAETGAGQHGV
ATATICARFGMECVVYMGAEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNIERTFYIIGTVAGPHPYPMMVRDFQRVIGDECKVQMPELAGRQPDAVIACVGGGSNA
MGIFYPYIDDAAVQLIGVEAAGDGLDTGHHAASLIAGSPGVLHGNRTYLLQDDDGQIIET
HSVSAGLDYPGVGPEHAWLKDSGRAQYVGITDEEALKAFHDCCRIEGIIPALESSHAIAY
GAKLAPTLPKDKILLVNLSGRGDKDMHTVAERSGITL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtataaccttcccgatgatcgcggccatttcggcccatatggcggcgtgttcgtcgcc
gaaacgctgattcacgcgctcgacgagctgcgtgccgcgtacgagaaattcaagaacgac
cccgagttcgttgccgaatacaaccgtgagctgaagcacttcgtcggccgtccgtcgccg
atctatcacgcgcagcgctggagcgagacgctcggcggcgcgcagatctacctgaagcgc
gaggacctgaaccacacgggcgcgcacaaggtgaacaacgtgatcggccaggcgctgctc
gccaagcgcatgggcaagcggcgcgtgatcgccgagacgggcgcgggccagcacggcgtc
gccaccgcgacgatctgcgcgcgcttcggcatggagtgcgtcgtctacatgggcgccgag
gacgtgcgccggcaggccgcgaacgtctaccggatgaagctgctcggcgcgaccgtcgtg
cccgtcgaatccggctcgcgcacgctgaaggatgcgttgaacgaggcgatgcgcgactgg
gtcacgaacatcgagcgcacgttctacatcatcggcacggtggcgggcccgcatccgtat
ccgatgatggtgcgcgacttccagcgcgtgatcggcgacgaatgcaaggtgcagatgccc
gagctcgccggccggcagcccgacgcggtgatcgcctgcgtcggcggcggctcgaacgcg
atgggcatcttctacccgtacatcgacgacgcggccgtccaattgatcggcgtcgaggcg
gcgggcgacgggctcgacaccggccatcacgcggcgtcgctgatcgccggcagcccgggc
gtgctgcacggcaaccgcacgtatctgctgcaggacgacgacggccagatcatcgagacg
cattcggtatcggccggcctcgactatccgggcgtcggccccgagcatgcctggctgaag
gacagcggccgcgcgcagtacgtcgggatcaccgacgaagaggcgctgaaggcgtttcac
gactgctgccggatcgaggggatcattcccgcgctcgaatcgagccacgcgatcgcctac
ggcgcgaagctcgcgccgacgctgccgaaggacaagatcctcctcgtcaacctgtcgggg
cgcggcgacaaggacatgcacacggtcgccgagcgatcgggcatcacgctctga

DBGET integrated database retrieval system