KEGG   Burkholderia mallei NCTC 10229: BMA10229_1858Help
Entry
BMA10229_1858     CDS       T00471                                 

Gene name
rsrIM
Definition
(GenBank) DNA modification methylase RsrI
  KO
K00571  
site-specific DNA-methyltransferase (adenine-specific) [EC:2.1.1.72]
Organism
bml  Burkholderia mallei NCTC 10229
Brite
Enzymes [BR:bml01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.72  site-specific DNA-methyltransferase (adenine-specific)
     BMA10229_1858 (rsrIM)
Prokaryotic defense system [BR:bml02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   DNA methyltransferases
    BMA10229_1858 (rsrIM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
II:1905234..1906082
Genome map
AA seq 282 aa AA seqDB search
MRDLIEEPAGGAASDAQATHAACALPAGIELHNRDFLHEAASLPDASIDLIVADPPYGLG
KDYGNDSDKRSGDEHLAWTREWLELAVPKLKSTGSMYVFCTWQYAPEIFSFLKTKLTMVN
EIIWDRRVPSMGGTTRRFTSVHDNIGFFAVSKGYYFDLDPVRIPYDADTKKARSRKLFEG
SKWLELGYNPKDVWSVSRLHRQHAERVDHPTQKPLEIIERMVLASCPPGGRVLDPFMGSG
TTAVACARQRRGFVGYEINESYCAIARERVASLAAVSAPADA
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgatctgatcgaagagccggcgggcggcgcggcgagcgacgcgcaggcgacgcac
gccgcgtgcgcgttgcccgccggcatcgaattgcacaatcgcgatttcctgcacgaggcc
gcgagcctgccggacgcgtcgatcgatctgatcgtcgccgatccgccatacgggctcggc
aaggactacggcaacgattcggacaagcgctcgggcgacgagcatctcgcgtggacgcgc
gagtggctcgagctcgcggtcccgaagctcaagtccaccggctcgatgtacgtgttctgc
acatggcagtacgcgcccgagatcttcagctttctgaagacgaagctcacgatggtcaac
gagatcatctgggaccggcgcgtgccgagcatgggcggcacgacgcgccgcttcacgtcg
gtgcacgacaacatcggctttttcgcggtttcgaagggctattacttcgatctcgatccg
gtccgcatcccgtacgacgccgatacgaagaaagcgcgctcgcgcaagctgttcgaaggc
agcaagtggctcgagctcggctacaacccgaaggacgtctggtccgtgtcgcgcctgcat
cgccagcatgcggagcgggtcgaccatccgacccagaagccgctggagatcatcgagcgg
atggtgctcgcgagctgcccgccgggcggccgcgtgctcgatccgttcatgggcagcggc
acgaccgcggtggcctgcgcgcggcagcggcgcggcttcgtcggctacgaaatcaacgaa
agctattgcgcgatcgcgcgcgaacgcgtcgcgtcgctcgcggccgtctccgcgccggcc
gacgcgtaa

DBGET integrated database retrieval system