KEGG   Burkholderia mallei NCTC 10229: BMA10229_1860Help
Entry
BMA10229_1860     CDS       T00471                                 

Gene name
accD
Definition
(GenBank) acetyl-CoA carboxylase, carboxyl transferase, beta subunit
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
bml00061  Fatty acid biosynthesis
bml00620  Pyruvate metabolism
bml00640  Propanoate metabolism
bml01100  Metabolic pathways
bml01110  Biosynthesis of secondary metabolites
bml01120  Microbial metabolism in diverse environments
bml01130  Biosynthesis of antibiotics
bml01200  Carbon metabolism
bml01212  Fatty acid metabolism
Module
bml_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bml00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMA10229_1860 (accD)
   00640 Propanoate metabolism
    BMA10229_1860 (accD)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    BMA10229_1860 (accD)
Enzymes [BR:bml01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     BMA10229_1860 (accD)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     BMA10229_1860 (accD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans Auto_anti-p27 IBR TF_Zn_Ribbon Tmemb_55A OrfB_Zn_ribbon
Motif
Other DBs
NCBI-ProteinID: ABM98452
Position
II:1907021..1907893
Genome map
AA seq 290 aa AA seqDB search
MSWLDKLLPPKIKQTDPKSRKGIPEGLWVKCPSCEAVLYRNDVDANQHVCPKCDHHMRIG
ARERLDALLDPEGRYEIGQEIVPVDTLKFKDSRKYPDRLKEAMDETGETDAMVVMGGAIH
TLPVVAACFEFSFMGGSMGSVVGERFARGAQNALEQQVPFICFASSGGARMQESLLSLMQ
MAKTTAMLTKLSEAKLPFISVLTDPTMGGVSASFAFLGDVVIAEPKALIGFAGPRVIEQT
VREKLPEGFQRAEFLLQKGAIDMIVDRRKMRDEIAQLLALLQRQPADALA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagctggctcgacaaactgttgccgccgaagatcaagcagaccgatccgaaaagccgc
aaggggattcccgagggcctgtgggtcaagtgcccgtcgtgcgaggccgtgctgtaccgc
aacgacgtcgatgcgaatcagcacgtgtgcccgaagtgcgatcaccacatgcgcatcggc
gcgcgcgagcgcctcgacgcgctgctcgatccggaaggccgctacgagatcggccaggag
atcgtcccggtcgatacgctgaagttcaaggacagccgcaagtatccggatcgactgaag
gaagcgatggacgagacgggcgagaccgacgcgatggtcgtgatgggcggcgcgatccac
acgctgcccgtcgtcgccgcgtgcttcgagttctcgttcatgggcggctcgatgggctcg
gtcgtcggcgagcgcttcgcgcgcggcgcgcagaacgcgctcgagcagcaggtgccgttc
atctgcttcgcctcgtcgggcggcgcgcggatgcaggaaagcctgctgtcgctgatgcag
atggcgaagaccaccgcgatgctcacgaagctctccgaagcgaagctgccgttcatctcg
gtgctgaccgatccgacgatgggcggcgtgtcggcgagcttcgcgtttctcggcgacgtc
gtgatcgccgagccgaaggcgctgatcggcttcgccggcccgcgcgtgatcgagcagacg
gtgcgcgagaagctgccggagggcttccagcgcgcggaattcctgctgcagaagggcgcg
atcgacatgatcgtcgaccgccgcaagatgcgcgacgaaatcgcgcagctgctcgcgctg
ttgcagcgccagccggccgacgcgctggcttga

DBGET integrated database retrieval system