KEGG   Burkholderia mallei NCTC 10229: BMA10229_1860Help
Entry
BMA10229_1860     CDS       T00471                                 

Gene name
accD
Definition
(GenBank) acetyl-CoA carboxylase, carboxyl transferase, beta subunit (EC:6.4.1.2)
  KO
K01963  
acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
Fatty acid biosynthesis
Tetracycline biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:bml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMA10229_1860 (accD)
   01212 Fatty acid metabolism
    BMA10229_1860 (accD)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BMA10229_1860 (accD)
   00640 Propanoate metabolism
    BMA10229_1860 (accD)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    BMA10229_1860 (accD)
  Metabolism of terpenoids and polyketides
   00253 Tetracycline biosynthesis
    BMA10229_1860 (accD)
Enzymes [BR:bml01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     BMA10229_1860 (accD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
II:1907021..1907893
Genome map
AA seq 290 aa AA seqDB search
MSWLDKLLPPKIKQTDPKSRKGIPEGLWVKCPSCEAVLYRNDVDANQHVCPKCDHHMRIG
ARERLDALLDPEGRYEIGQEIVPVDTLKFKDSRKYPDRLKEAMDETGETDAMVVMGGAIH
TLPVVAACFEFSFMGGSMGSVVGERFARGAQNALEQQVPFICFASSGGARMQESLLSLMQ
MAKTTAMLTKLSEAKLPFISVLTDPTMGGVSASFAFLGDVVIAEPKALIGFAGPRVIEQT
VREKLPEGFQRAEFLLQKGAIDMIVDRRKMRDEIAQLLALLQRQPADALA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagctggctcgacaaactgttgccgccgaagatcaagcagaccgatccgaaaagccgc
aaggggattcccgagggcctgtgggtcaagtgcccgtcgtgcgaggccgtgctgtaccgc
aacgacgtcgatgcgaatcagcacgtgtgcccgaagtgcgatcaccacatgcgcatcggc
gcgcgcgagcgcctcgacgcgctgctcgatccggaaggccgctacgagatcggccaggag
atcgtcccggtcgatacgctgaagttcaaggacagccgcaagtatccggatcgactgaag
gaagcgatggacgagacgggcgagaccgacgcgatggtcgtgatgggcggcgcgatccac
acgctgcccgtcgtcgccgcgtgcttcgagttctcgttcatgggcggctcgatgggctcg
gtcgtcggcgagcgcttcgcgcgcggcgcgcagaacgcgctcgagcagcaggtgccgttc
atctgcttcgcctcgtcgggcggcgcgcggatgcaggaaagcctgctgtcgctgatgcag
atggcgaagaccaccgcgatgctcacgaagctctccgaagcgaagctgccgttcatctcg
gtgctgaccgatccgacgatgggcggcgtgtcggcgagcttcgcgtttctcggcgacgtc
gtgatcgccgagccgaaggcgctgatcggcttcgccggcccgcgcgtgatcgagcagacg
gtgcgcgagaagctgccggagggcttccagcgcgcggaattcctgctgcagaagggcgcg
atcgacatgatcgtcgaccgccgcaagatgcgcgacgaaatcgcgcagctgctcgcgctg
ttgcagcgccagccggccgacgcgctggcttga

DBGET integrated database retrieval system