KEGG   Burkholderia mallei NCTC 10229: BMA10229_1877Help
Entry
BMA10229_1877     CDS       T00471                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bml00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BMA10229_1877
   00052 Galactose metabolism
    BMA10229_1877
   00500 Starch and sucrose metabolism
    BMA10229_1877
   00520 Amino sugar and nucleotide sugar metabolism
    BMA10229_1877
Enzymes [BR:bml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BMA10229_1877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
II:1926923..1927261
Genome map
AA seq 112 aa AA seqDB search
MWWLFFCPGFREPGHFCIRAERGAAGGPTSHGAPAALLPAYRPRIARVPPALARLTHCEP
NQRTRRPTARSLRADPWGRAAVSNRAGAAGPACGTALPAMWPCRMKSSRDAA
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
gtgtggtggttgttcttttgccccggttttcgcgagccggggcatttttgtatccgcgcc
gaacgcggcgcggcgggcggaccgacatcgcacggcgcgccggctgcgctgttgccggca
tatcgcccgcgcatcgcccgcgtgccgcccgcgctcgcgcgcttgacgcattgcgagccg
aaccagcgaacgcgccgcccgaccgcgcgttcgcttcgcgcggatccatgggggcgcgcc
gccgtctcgaatcgtgccggcgcggccggcccggcgtgcggaaccgcgttgccggcgatg
tggccgtgccgcatgaagtcgtcgcgcgatgcggcgtga

DBGET integrated database retrieval system