KEGG   Burkholderia mallei NCTC 10229: BMA10229_1877Help
Entry
BMA10229_1877     CDS       T00471                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bml  Burkholderia mallei NCTC 10229
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
II:1926923..1927261
Genome map
AA seq 112 aa AA seqDB search
MWWLFFCPGFREPGHFCIRAERGAAGGPTSHGAPAALLPAYRPRIARVPPALARLTHCEP
NQRTRRPTARSLRADPWGRAAVSNRAGAAGPACGTALPAMWPCRMKSSRDAA
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
gtgtggtggttgttcttttgccccggttttcgcgagccggggcatttttgtatccgcgcc
gaacgcggcgcggcgggcggaccgacatcgcacggcgcgccggctgcgctgttgccggca
tatcgcccgcgcatcgcccgcgtgccgcccgcgctcgcgcgcttgacgcattgcgagccg
aaccagcgaacgcgccgcccgaccgcgcgttcgcttcgcgcggatccatgggggcgcgcc
gccgtctcgaatcgtgccggcgcggccggcccggcgtgcggaaccgcgttgccggcgatg
tggccgtgccgcatgaagtcgtcgcgcgatgcggcgtga

DBGET integrated database retrieval system