KEGG   Burkholderia mallei NCTC 10229: BMA10229_1996Help
Entry
BMA10229_1996     CDS       T00471                                 

Gene name
speB
Definition
agmatinase
Orthology
K12255  
guanidinobutyrase [EC:3.5.3.7]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bml00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BMA10229_1996 (speB)
Enzymes [BR:bml01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.7  guanidinobutyrase
     BMA10229_1996 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(2052497..2053450)
Genome map
AA seq 317 aa AA seqDB search
MSDDYFQPQSGNAMPRFAGIATMMRLPQAASAAGLDACFVGVPFDLGTSNRTGARFGPRQ
IRSESVLLRPYNMATRAAPFDSLRVADLGDVATNPYNLADSIARIEAAYHAILAHGCRPV
TLGGDHTITLPILRAMHRRHGRVGLIHVDAHADVNDTMFGEKIAHGTPFRRALEEGLLDG
DRVVQIGLRGTGYAAEDFDWCRDQGFRVVQAEACWNRSLAPLMDEVRARVQGGPVYLSFD
IDGIDPAYAPGTGTPEIAGLTVPQGLEIVRGAWGLDIVGADLVEVAPPYDPFGTTALLGA
NLAYEMLCVLPGVARRA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatgactacttccagccgcaaagcggcaacgcgatgccgcgcttcgccggcatc
gcgacgatgatgcggctgccgcaggcggcgagcgccgcggggctcgacgcgtgctttgtc
ggcgtgccgttcgatctcggcacgtcgaaccgcaccggcgcgcggttcggcccgcgccag
atccgcagcgaatccgtgctgctgcgcccgtacaacatggccacgcgcgcggcgccgttc
gattcgctgcgcgtcgccgatctcggcgacgtcgcgacgaacccgtacaacctcgccgat
tcgatcgcgcggatcgaggccgcgtaccacgcgatcctcgcgcacggctgccgcccggtc
acgctcggcggcgaccacacgatcacgctgccgatcctgcgtgcgatgcatcgccggcac
gggcgcgtcgggctcatccacgtcgacgcgcacgcggacgtcaacgacacgatgttcggc
gagaagatcgcgcacggcacgccgtttcgccgcgcgctcgaggaagggctgctcgacggc
gaccgcgtcgtgcagatcggcttgcgcggcaccggctatgcggccgaggatttcgactgg
tgccgcgatcagggctttcgcgtcgtccaagccgaggcgtgctggaaccgctcgctcgcg
ccgctgatggacgaagtgcgcgcgcgcgtgcaaggcggcccggtctatctgagcttcgac
atcgacggcatcgatccggcgtacgcgccgggcaccggcacgccggagatcgccggcctc
acggtgccgcagggcctcgagatcgtgcgcggcgcgtgggggctcgacatcgtcggcgcc
gatctcgtcgaggtcgcgccgccgtacgatccgttcggcaccaccgcgctgctcggcgcg
aacctcgcttacgagatgctctgcgtgctgcccggcgtggcgcggcgcgcgtga

DBGET integrated database retrieval system