KEGG   Burkholderia mallei NCTC 10229: BMA10229_2008Help
Entry
BMA10229_2008     CDS       T00471                                 

Gene name
bcsE
Definition
(GenBank) cellulose biosynthesis protein BcsE
Organism
bml  Burkholderia mallei NCTC 10229
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
II:2067060..2069324
Genome map
AA seq 754 aa AA seqDB search
MNDSRVKSPDPVPGRPASGGAGARALARLRALWRVCSRAARPREPAHAANRLAIDALPDE
WAELAPGGLYAVYAAACTSACDALIWDSVRDARTRDVTVVLARERAAVATRLRELGFVDG
MHARGWPRRLNVLAMPPGDIAARGAAREGAPAPAPVPAPAFSRLVGGLRALRRYRFRSNA
LYFVEGAERWFSWHDPVALTHEGWALAGWCRSRRIALVLLIDPRASQAAASRADARHTAP
LPDAPDAPDAFDAGDGVLGGARAEHGADDRTTLFAADRARAARGGFHGACAGVAQLQRTH
GELRWRVDFWRSRGAVATGEVRALRFVGDGRLAAVPAAGAHAAGDGARLAFDEARVVVSR
RVVERESWVPGDWEVVDDNDAVLAACAGAHAASAVLAFTGRAQLEALCATIHALRLRCGG
ALKIVVVERGEAMRHQFELLALNLGANQVVARNLPFSRVLAVLRSLQGQLHARPVAADYR
AALAASLGDTALGYLPVGAFCSQARAVLERSAVLALSHTLVKLTLLPGVAHAHALRACTP
RRAGDVLTADAQHLYLFLFACELADANDVLGHLFDVPVERISDRVVHLAQDSIEHELNAL
DAANRRAPIADYSDLFSPAAVATRAAGARASAGAPAAARDGEPSAEPMSPHVPPHAPHVS
GAPTPPGTRAAAHGPPWCSAFALSSASQTSRTSPASAQIVVPPPQAPSNVSHAPLSATPR
APRPRRPHDAGAVAGVRTRTATRDAMPLRPREAE
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atgaacgactcacgcgtgaaatccccggacccggtgcccggccggcccgcgagcggcggg
gccggtgcgcgcgcgctcgcccgcctgcgcgcgttgtggcgcgtgtgctcgcgcgcggcg
cggccgcgcgagcccgcgcatgcggcgaaccggctcgcgatcgacgcgctgcccgacgag
tgggccgagctcgcgccgggcggcctgtatgcggtgtacgcggcggcgtgcacgagcgcg
tgcgacgcgctgatctgggacagcgtgcgggacgcgcgcacgcgcgacgtcacggtggtg
ctcgcgcgcgagcgcgcggcggtcgcgacgcggctgcgcgagctcggcttcgtcgacggc
atgcacgcgcgcggctggccgcggcggttgaacgtgctggcgatgccgccgggcgatatc
gcggcgcgcggcgcggcgcgtgagggcgcacccgcgcccgcgcccgtgcctgcgcccgcg
ttctcacgcctcgtcggcggcctgcgcgcgctgaggcgctaccgcttccgttcgaacgcg
ctgtatttcgtcgaaggcgcggagcgctggttcagttggcacgatccggtcgcgctgacg
cacgaggggtgggcgctggccggctggtgccgttcgcgtcggatcgcgctcgtgctgctg
atcgatccgcgggcgtcgcaagcggccgcgagccgcgccgatgcgcggcacacggccccg
ctgcccgacgcacccgatgcacctgacgcattcgacgcgggtgacggcgtgctcggcggc
gcgcgcgcggagcacggcgccgacgatcgcaccacgctcttcgccgccgatcgcgcgcgc
gccgcgcgcggcggctttcacggcgcgtgcgcgggcgtcgcgcaattgcagcgcacgcac
ggcgagctgcgctggcgggtcgatttctggcgctcgcgcggcgcggtcgccacgggcgag
gtgcgcgcgctgcgcttcgtcggcgacggacggctcgcggccgtgccggcggccggcgcg
cacgcggcgggcgacggcgcgcggctcgcgttcgacgaggcgcgcgtcgtcgtcagccgc
cgcgtggtcgagcgcgaatcgtgggtgccgggcgattgggaagtcgtcgacgacaacgac
gcggtgctcgccgcgtgcgccggcgcgcatgcggcgagcgcggtgctggcgtttaccggc
cgcgcgcagctcgaagcgctgtgcgcgacgatccatgcgctgcgcctgcggtgcggcggc
gcgctgaagatcgtcgtcgtcgagcgcggcgaggcgatgcgccatcaattcgagctgctc
gcgctgaacctcggcgcgaaccaggtcgtcgcgcgcaacctgccgttctcgcgcgtgctc
gcggtgctgcgctcgctgcagggccagttgcacgcgcgcccggtcgcggccgactatcgg
gccgcgctcgccgcgtcgctcggcgacacggcgctcggctatctgcccgtcggcgcgttc
tgctcgcaggcgcgcgcggtgctcgagcgcagcgcggtgctcgcgctgtcgcatacgctc
gtgaagctgacgctgctgcccggcgtcgcgcacgcgcacgcgttgcgcgcgtgcacgccg
cgccgcgcgggcgacgtgctgaccgccgacgcgcagcacctgtatctgttcctgttcgcc
tgcgagctcgccgatgcgaacgacgtgctcggccacctcttcgacgtgcctgtcgagcgg
atctcggatcgcgtcgtgcatctcgcgcaggacagcatcgagcatgagctgaatgcgctc
gacgcggcgaaccggcgtgcgccgatcgcggattacagcgatctcttttcgccggcggcg
gtggcgacgcgcgcggccggcgcgcgcgcctcggccggcgctccggcggcggcgcgcgac
ggcgaaccgtccgccgagcctatgtcgccgcatgtgccgccgcatgcgccgcatgtgtcg
ggcgcgccgacgccgccgggcacgcgcgccgcggcgcacggaccaccgtggtgctcggcg
ttcgcgctgtcgtccgcatcgcagacctcgcggacatcgcccgcctcggcgcagatcgtc
gtaccgccgccgcaggcgccgtcgaacgtatcgcacgcgccgctgtccgcgacgccgcgc
gcgccgcgaccgcgccgaccgcacgacgccggcgcggtcgccggcgtgcgcacccgcacc
gccacgcgcgacgcgatgccgttgcgccccagggaggctgaatga

DBGET integrated database retrieval system