KEGG   Burkholderia mallei NCTC 10229: BMA10229_2008Help
Entry
BMA10229_2008     CDS       T00471                                 

Gene name
bcsC
Definition
endo-1,4-D-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bml00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BMA10229_2008 (bcsC)
Enzymes [BR:bml01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BMA10229_2008 (bcsC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:2060802..2062328
Genome map
AA seq 508 aa AA seqDB search
MARQAGRDEGVGRIGREAGDAREAAGAGEACGRRHARADAWARRASRASRGWRTFWRGGG
RGRVRAVVASVVASFSVMAFAAATLPVSWRVAAAAERTRSGGERAGGLRDTAGLIEISAA
APASTPIPAAPRRFAQPFAQPARAFAVASACAPSWPRWDRFKRDFVSADGRVIDVGSADE
RTVSEGQAYGLFFALVANDRAAFDALLRWTEDNLAQGDLSARLPAWLWGRAADGAWRVLD
ANAASDADLWLAYALLEAGRLWRERSYTARGALLAKRVLDEETATLPGLGLVLLPGPMGF
RPARDAWRLNPSYSPPQAIRGIGAHVPDDARWARLAAGFGRVLTDSAPRGFAPDWALYRA
GRGFEPDAETHAVSAYNAIRVYLWAGMLDAGDPLARPLVAHFAPFAEHVAAHGAPPEAVD
ATTGAAAPRDGNAGFSAAAVPFLEARGERASADAQLARVARLERETASGYYANVLTLFGL
GWRDGRYRFAADGTLRVRWSEPCSTPAR
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggcgcggcaagcggggcgagacgaaggcgtcgggcgcatcgggcgtgaagcgggcgac
gcgcgcgaggcggccggggcgggcgaggcgtgcgggaggcgccacgcgcgggccgacgcg
tgggcgcggcgggcgtcgcgagcatcgcgcgggtggcgcacgttttggcgcgggggcggg
cgtgggcgcgtgcgcgccgtcgtggcgagcgtcgtggcgagcttctcggtgatggcgttc
gcggcggcgacgttgccggtgtcgtggcgcgtcgccgcggcggcggagcgtacgcgaagc
ggcggcgaacgcgcgggcgggctgcgcgacacggcgggcttgatcgagatctcggcggcg
gcgccggcctcgacgccgatcccggcggcgccgcggcggttcgcgcagccgttcgcgcag
ccggctcgcgcgttcgccgtcgcgagcgcctgcgcgccgtcctggccgcgctgggaccgt
ttcaagcgtgacttcgtatcggccgacggccgcgtgatcgacgtcggctcggccgacgag
cggaccgtatccgaggggcaggcgtacggccttttcttcgcgctcgtcgcgaacgaccgc
gcggcgttcgacgcgctgctgcgctggaccgaggacaatctcgcgcagggcgatctgagc
gcgcgtctgcccgcgtggctgtggggccgcgcggccgacggcgcgtggcgcgtgctcgat
gcgaacgccgcgtccgacgccgatctgtggcttgcgtacgcgctgctcgaagcggggcgc
ttgtggcgcgagcgcagctacacggcgcgcggcgcgttgctcgcgaagcgcgtgctcgac
gaggagaccgcgacgctgccggggctcggtctcgtgctgctgccgggcccgatgggtttt
cggccggcgcgcgacgcgtggcggctgaatccgagctattcgccgccgcaggcgattcgc
gggatcggcgcgcatgtgcccgacgacgcgcgctgggcgcggctcgcggcgggcttcggc
cgcgtgctgaccgacagcgcgccgcgcggcttcgcgccggactgggcgctgtatcgcgcg
ggccgcggcttcgagccggacgccgaaacgcatgcggtgagcgcgtacaacgcgattcgc
gtctatctgtgggcgggcatgctcgatgcgggcgatccgctggcgcggccgctcgtcgcg
catttcgcgccgttcgccgagcatgtcgccgcgcatggcgcgccgccggaggcggtcgat
gcgacgacgggcgcggccgccccgcgcgacggcaatgccgggttttccgcggcggccgtg
ccgtttctcgaggcgcgcggcgagcgggcgagcgccgacgcgcagctcgcgcgcgtcgcg
cggctcgagcgcgagacggcgagcggctattacgcgaacgtgctgacgctgttcgggctc
ggctggcgcgacgggcgctaccggttcgcggccgacggcacgctgcgggtgcgatggagc
gagccgtgctcgacgcccgcgcgttga

DBGET integrated database retrieval system