KEGG   Burkholderia mallei NCTC 10229: BMA10229_A0047Help
Entry
BMA10229_A0047    CDS       T00471                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bml00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BMA10229_A0047 (recR)
DNA repair and recombination proteins [BR:bml03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BMA10229_A0047 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:44998..45600
Genome map
AA seq 200 aa AA seqDB search
MSIKPPSALSELVEALRALPGVGPKSAQRIAYHLMQHDREGAERLGRSLLFATEHLRHCE
KCNTFTEAQICEVCSDPERDPALLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLDGIG
PKEIHFDRLVRRASDGIVKEVVLATNFTNEGEATAHYLGQTLKARGLAVTRLARGVPVGG
ELEYVDAGTIARAMLDRRTL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcaagccgccgtccgcgctgtccgagctcgtcgaggcgctgcgcgcgctgccg
ggcgtcgggccgaaatccgcgcaacgcatcgcgtatcacctgatgcagcacgatcgggag
ggcgccgagcggctcggccggtcgctgctgttcgcgaccgagcacctgcggcattgcgag
aagtgcaacacgttcacggaggcgcaaatctgcgaggtgtgcagcgatccggagcgcgat
ccggcgctgctgtgcgtcgtcgagacgcccgccgatcagatcatgctcgagcagacgatg
acctatcgcgggctgtacttcgtgctgatggggcgcctgagcccgctcgacggcatcggg
ccgaaggaaatccatttcgaccggctcgtgcgccgcgcgtccgacggcatcgtgaaggag
gtcgtgctcgcgacgaacttcacgaacgagggcgaggcgaccgcgcactacctcggccag
acgctgaaggcgcgcggcctggccgtcacgcggctcgcgcgcggcgtaccggtgggcggc
gagctcgaatacgtcgatgcgggcacgatcgcgcgcgcgatgctcgaccggcgcacgctt
tag

DBGET integrated database retrieval system