KEGG   Burkholderia mallei NCTC 10229: BMA10229_A0051Help
Entry
BMA10229_A0051    CDS       T00471                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bml  Burkholderia mallei NCTC 10229
Brite
Enzymes [BR:bml01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BMA10229_A0051 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:47738..48706
Genome map
AA seq 322 aa AA seqDB search
MSGERAKRFPLALEDLKREPRKPEGRVAERQAAGDAARQRLTAAAAVPAAASPIVPERRA
PHGGVFAAKPARAKQHAPAAPGAAKRAPQGGAKQGDRSAAPNVALSGALALTSERVRERM
VERLRANGVADPRVLAAMSAVPRHMFVDPGLAAQAYEDAALPIGHQQTISKPSVVARMIE
LAAAGRALERVLEIGTGCGYQAAVLSRVARDVYSIERVRPLYERAKLNLRPLRVPNIRLH
YGDGRVGLPAAAPFDAIVIAAAGLDVPRALLEQLAIGGRLVAPVGEQAGEQVLTLVERVA
PAQWRESRLDRVFFVPLKSGVI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgagcgcgcgaagcggtttccgctcgcgctcgaggatctgaagcgcgagccg
cgcaagcccgagggccgcgtggcggagcgccaggcggcgggagacgccgcccgccagcgc
ctcaccgcggccgccgccgtgcccgccgctgcttctccgatcgtgcccgaacgccgcgcg
ccgcacggcggcgtgttcgccgcgaaacccgcgcgtgcgaagcagcacgcgcctgcggcg
cccggcgccgcgaagcgcgcgccgcaggggggcgcgaagcagggggaccggagcgccgcg
ccgaacgtcgcgctgagcggcgcgctcgcgctgacttcggaacgtgtgcgcgagcgcatg
gtcgaacggctgcgggcaaacggcgtggccgatccgcgcgtgctcgccgcgatgtcggcc
gtgccgcgccacatgttcgtcgatcccgggctcgcggctcaggcgtacgaggacgccgcg
ctgccgatcggccatcagcagacgatctcgaagccgtcggtcgtcgcgcgcatgatcgag
ctcgcggcggcgggccgcgcgctcgagcgcgtgctcgaaatcggcacgggctgcggctat
caggccgcggtgctgagccgcgtcgcgcgcgacgtgtattcgatcgagcgcgtgaggccg
ctctacgagcgcgcaaaactgaatttgcggccgctgcgcgtgccgaacatccgcctgcac
tacggcgacggacgcgtgggcctgcccgccgcggcgccgttcgacgcgatcgtgatcgcg
gcggcggggctcgacgtgccgcgggcgctgttggaacaattggcgatcggcggcaggctc
gtcgcgcctgtcggagagcaggcgggcgagcaggtgctgacgctcgtggagcgcgtcgca
cccgcgcagtggcgcgagtcgcggcttgatcgcgttttctttgtccctttaaaatccgga
gtgatttga

DBGET integrated database retrieval system