KEGG   Burkholderia mallei NCTC 10229: BMA10229_A0275Help
Entry
BMA10229_A0275    CDS       T00471                                 

Definition
magnesium-chelatase subunit
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bml00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BMA10229_A0275
Enzymes [BR:bml01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     BMA10229_A0275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(287325..288608)
Genome map
AA seq 427 aa AA seqDB search
MNPTNEAGAATAAASDDRALPAAYPFSALIGQAALQQALLLVAVDPGLGGVLVSGPRGTA
KSTAARALAELLPEGRFVTLPLSASDEQVTGSLDLASALADNTVRFSPGLVARAHLGVLY
VDEINLLPDALVDALLDAAASGVNTVERDGVSHSHAARFALVGTMNPEEGELRPQLLDRF
GLMVELANCYDAATRQRIVKARLAFDLDPHGFRAQYRDAQAALVAQIRAARAALPALAFD
DAAHARVAELCIGAAVDGLRGDLVMLRAARALAALDGAARVAAAHVERVAADVLRHRRTR
FEPQPEFQPGFQPGSQAGPQPMGRREPPPASRSAGGDAPGGRADPGEAEATRAPTPRDAL
PGGASGPAHPAARAPSDAQRRAADERAAARDGGRGPAADDSDWGYLPPEPAGIAPVKGVI
PLPLKKR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
ttgaacccaacgaacgaagccggcgcggcaacggccgccgcctccgacgaccgcgcattg
ccggccgcctatccgttttccgcgctgatcggccaggcggcgttgcagcaggcgctgctg
ctcgtcgccgtcgatccgggcctgggcggcgtgctcgtgagcggcccgcgcggcaccgcg
aaatcgaccgccgcgcgcgcgctcgccgagctgctgcccgaggggcgcttcgtcacgctg
ccgctgtcggccagcgacgagcaggtgacgggttcgctcgacctcgcgagcgcgctcgcc
gacaatacggtgcgcttttcgcccggcctcgtcgcgcgcgcgcatctcggcgtgctgtac
gtcgacgagatcaacctgctgccggacgcgctcgtcgacgcgttgctcgacgcggccgcg
agcggcgtcaacacggtcgagcgcgacggcgtgtcgcacagccacgcggcgcgcttcgcg
ctcgtcggcacgatgaacccggaagagggcgagttgcgcccgcaactgctcgaccgtttc
gggctgatggtggagctcgcgaactgctacgacgcggcgacgcggcagcggatcgtcaag
gcgcggctcgcgttcgatctcgatccgcacggctttcgcgcgcagtaccgcgacgcgcag
gcggcgctcgtcgcgcaaattcgcgcggcgcgcgccgcgctgccggcgctcgcgttcgac
gacgccgcgcacgcgcgcgtcgccgagctgtgcatcggcgcggccgtcgacggcctgcgc
ggcgacctcgtgatgctgcgcgccgcgcgggcgctcgcggcgctcgacggggcggcgcgc
gtcgccgcggcgcacgtcgagcgcgtcgccgccgatgtgctgcgccatcggcgcacgcgg
ttcgagccgcaacctgaatttcagcccggatttcaacccgggtctcaagccgggcctcag
ccgatggggcgacgcgagcctccgcccgcatcgcgttcggccggcggcgacgcgccgggc
gggcgcgcggatccgggcgaagccgaagccacgcgcgcgcccacgcctcgcgacgcgctg
cccggcggcgcgagcggaccggcgcatcccgctgcgcgcgcgccgtccgacgcgcagcgg
cgcgcggcggacgagcgcgccgcggcgcgcgacggcggccgtgggccggccgccgacgat
agcgactggggctatctgccgcccgagccggcgggcatcgcgcccgtcaagggcgtgatc
ccgctgccgctaaaaaaacgctga

DBGET integrated database retrieval system