KEGG   Burkholderia mallei NCTC 10229: BMA10229_A0423Help
Entry
BMA10229_A0423    CDS       T00471                                 

Gene name
galU-1
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bml00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BMA10229_A0423 (galU-1)
   00052 Galactose metabolism
    BMA10229_A0423 (galU-1)
   00500 Starch and sucrose metabolism
    BMA10229_A0423 (galU-1)
   00520 Amino sugar and nucleotide sugar metabolism
    BMA10229_A0423 (galU-1)
Enzymes [BR:bml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BMA10229_A0423 (galU-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:443121..444002
Genome map
AA seq 293 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKEKLLDLVRSIKPSHVDCFYVRQPEALGLGHAVLCAEK
LVADNPFAVILADDLLDGDPPVMKQMVDVFDHYHSSVIGVEEIPPEDTKSYGIVDGKEWE
DSIIKMSAIVEKPAPEVAPSNLGVVGRYVLKPRIFDHLRALKPGAGGELQLTDAIQALLA
DEQVLAYKYRGTRFDCGSKLGYLKATVEFALRHPEVKTEFETYLRSRSETQHG
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtcaccaaggcggttttcccggtcgcgggcctgggcacgcggtttctgccc
gccaccaaggcgagtccgaaggaaatgctgcccgtcgtcgacaaaccgttgatccagtat
gcggtggaagaagcgattgcagccggcatcaccgagatgatcttcgtgacgggccgcagc
aagcgcgcgatcgaggaccatttcgacaagtcgtacgagatcgaagcggagctcgaggcg
cgcggcaaggaaaagctgctcgatctcgtgcgcagcatcaagccgagccacgtcgactgc
ttctacgtgcgccagccggaagcgctcggcctgggccacgcggtgctgtgcgcggagaag
ctcgtcgcggacaatccgttcgcggtgatcctcgccgacgacctgctcgacggcgatcca
cccgtgatgaagcagatggtggacgtgttcgaccactatcacagctcggtgatcggcgtc
gaggagattccgcccgaggacacgaagtcgtacgggatcgtcgacggcaaggaatgggaa
gactcgatcatcaagatgtcggcgatcgtcgagaaacccgcgcccgaagtcgcgccgtcg
aacctcggcgtcgtcggccgctacgtgctcaagccgcgcatcttcgatcacctgcgcgcg
ctcaagccgggcgcgggcggcgagctgcagttgaccgacgcgatccaggcgctcctcgcg
gacgaacaggtgctcgcatacaagtatcgcggcacccgcttcgactgcggcagcaagctc
ggctatctgaaggcgacggtcgagttcgcgctgcgccaccccgaagtgaagaccgagttc
gaaacgtatctgcgctcgcgcagcgaaacgcaacacgggtaa

DBGET integrated database retrieval system