KEGG   Burkholderia mallei NCTC 10229: BMA10229_A0462Help
Entry
BMA10229_A0462    CDS       T00471                                 

Definition
beta-N-acetylglucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bml00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bml00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
I:complement(485423..486826)
Genome map
AA seq 467 aa AA seqDB search
MVQGMKSERVIGTFKHFPGHGDTDTDSHYGLPVVIKSRADAYAIDLAPYRQAIEAGEAPD
MIMTAHIQYPSLDDTRVATRTGEQMIAPATMSRRIQHDILRGEFGYQGVTITDALDMKGI
AGFFDEDDAVVKVFQADVDIALMPVEFRTAADAGRLAALVDRVAAAVDSGRIDRAEFDRS
VRRIVLTKLRHGIVASDRGRPVNELASIGGPAHRAIERDIAQKSITVLRNENGALPLQAA
GRRIFILTPWGEQAEAMRRRFVELGHPLVTGAKLSAITWAEQQQAIDAADVVIVGTLSTG
VTPVEHNGDPNARVSPPAPSAVRMRQAAPANGEEEGSVIFDHVEGADAAKDIGARPSVLA
AIAAPSEAQQMRDAMDYAKARRKTVIHVTMRAPYDVISYDDVADATLATYAYYGYEGGLR
GPSLPAAVDAMLGVARPVGRLPVAIHALNADGSTGPLRYARGFGLQY
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagggcatgaagagcgagcgcgtgatcggcacgttcaagcattttcccgggcac
ggcgacacggataccgattcgcactacggactgcccgtcgtgatcaagtcgcgcgccgac
gcctacgcgatcgatctcgcgccgtaccggcaggcgatcgaagcgggcgaggcgcccgac
atgatcatgaccgcgcacatccagtatccgtcgctcgacgacacccgcgttgcgacccgc
acgggcgagcagatgatcgcgcccgcgacgatgtcgcggcgcatccagcacgatatcctg
cgcggcgagttcggctatcagggcgtgacgatcaccgacgcgctcgacatgaagggcatc
gccggcttcttcgacgaggacgacgcggtcgtcaaggtgttccaggcggacgtcgacatt
gcgctgatgcccgtcgagtttcgcaccgcggccgatgccgggcgcctggcggcgctcgtc
gatcgcgtcgccgcggcggtcgattcggggcggatcgatcgcgccgagttcgatcgctcg
gtgcgccgtatcgtgctgacgaagctgcgccacggcatcgtcgcgtcggatcgcggccgg
ccggtcaacgagctggcatcgatcggcgggcccgcgcaccgcgcgatcgagcgcgacatc
gcgcaaaaatcgatcaccgtgctgcgcaacgagaacggcgcgctgccgctgcaggccgcg
ggccggcgcatcttcatcctgacgccgtggggcgagcaggccgaggcgatgcggcggcgt
ttcgtcgagcttggccatccgctcgtcacgggcgcgaagctgagcgcgatcacgtgggcc
gaacagcagcaggcgatcgatgcggccgacgtcgtgatcgtcggcacgctatcgacgggc
gtgacgcccgtcgagcacaacggggatccgaacgcgcgcgtgagcccgccggcgccgtcg
gccgtgcggatgcggcaggccgcgcccgcgaacggcgaggaggagggttcggtgatcttc
gaccacgtcgagggggcggacgcggcgaaggacatcggcgcgcgcccgagcgtgctcgcg
gcgatcgcggcgccgagcgaggcgcagcagatgcgcgacgcgatggactacgcgaaggcg
cggcgcaagaccgtgatccacgtgacgatgcgcgcgccgtacgacgtgatcagctacgac
gatgtcgcggacgcgacgctcgccacctacgcgtactacggctacgaaggcggcttgcgc
ggcccgtcgctgcccgcggccgtcgacgcgatgctcggcgtcgcgcggccggtcggcagg
ctgccggtcgcgatccacgcgctgaacgcggacggatcgacggggccgctgcgctacgcg
cgcggattcgggttgcagtactga

DBGET integrated database retrieval system