KEGG   Burkholderia mallei NCTC 10229: BMA10229_A0539Help
Entry
BMA10229_A0539    CDS       T00471                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bml00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BMA10229_A0539 (malQ)
Enzymes [BR:bml01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     BMA10229_A0539 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:562648..564870
Genome map
AA seq 740 aa AA seqDB search
MTADPRHPSIVELADAAGLDAHWIDASGFARRVGDDMLAALLDALGYPCDTRAARAESAA
RLAAHAQAAPRLVTGDVDAPLTLPASLGRPGACYRVTLENGDAVAGRFAQPAGAAVLPPL
ATPGYHVLDTGEQRTTLAIAPPSAWTPADAMRAAAAGGRERPPPWGLAAQLYGLRREADG
GIGDFTALAACARAAARRGAHALAISPTQAAFPALPEHDSPYSPSSRLWRNAAYIDVETV
LGAHAARAAIADAGLAAQWSALTRAPLVDWPGAVPAKLRVLRLLFDRWRAQAPTGADAGP
RAFARFRARHAGALDAHATFDALQACCIDNGIGADWRRWPPAWRTPDAPDVAAFARAHAH
DIAFHAFLQWQAARGLAAAQRAARGRGMAIGLIADLPVGCDAAGSDAWRDGDAMLRGLSI
GAPADPFNARGQAWGVTTWTPTALRARGFAPFVECLRAGFAHAGGVRIDHVLGLARLWVV
RDGAPPRDGAYLRYPRDDLLRLAALESFRHRAIVIGEDLGTVPADFRARIAARGIVGLRA
LWFERDPAGAFRAPGDWDRHAAATSSTHDLPTVAGWWRGVDLGWRWHAAASASACAPASS
LSPASDAEAEANAPPARPGESEVAGPDALPPEVRDMRRAERAALWRALQQAGVAARGQKM
PPRDAPPVGAILAYVAQAPAPLAIFPLEDLLALEGQPNVPGPPCGHPNWRRRMPRSVDAL
FDAPARTRIAAVRRARKRAR
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgatccgcgtcatccgtcgatcgtcgagctcgcggacgcggccgggctcgac
gcgcactggatcgacgcatcgggcttcgcgcggcgggtcggcgacgacatgctcgcggcg
ttgctcgacgcgctcggctacccgtgcgacacgcgcgcggcgcgcgccgagagcgccgcg
cggctcgcggcgcacgcgcaggccgcgccgcggctcgtgacgggcgacgtcgacgcgccg
ctcacgctgcccgcctcgctcggacgccccggcgcgtgctaccgggtcaccctcgaaaac
ggcgacgccgtcgccggccgcttcgcgcagcccgccggcgcagccgtgctgccgccgctc
gcgacgcccggctaccacgtgctcgacaccggcgagcagcgcacaacgctcgccatcgca
ccgccatccgcatggacgcccgccgacgcgatgcgcgccgcggcggccggcggccgcgaa
cgcccgccgccgtggggcctcgcggcgcaactctacgggctgcgccgcgaggccgacggc
ggcatcggcgatttcaccgcgctcgccgcctgcgcgcgcgccgccgcccggcgcggcgcg
cacgcgctcgcgatcagcccgacgcaggcggccttccccgcgctgcccgagcacgacagc
ccgtactcgccttcgtcgcggctttggcgcaacgccgcctacatcgacgtcgaaacggtg
ctcggcgcgcacgcggcgcgcgcggcgatcgccgatgcggggctcgccgcgcaatggagc
gcgctcacgcgcgcgccgctcgtcgattggcccggcgcggtgccggcgaagctgcgcgtg
ctgcgcctgctgttcgaccgctggcgcgcgcaggcgcccacgggcgcggatgcgggcccg
cgggcgttcgcgcgctttcgggcacggcacgccggcgcgctcgacgcacatgcgacgttc
gacgcgttgcaggcgtgctgcatcgacaacggcatcggcgcggactggcggcgttggccg
cccgcatggcgcacgcccgatgcgccggacgtcgccgcgttcgcgcgcgcgcacgcgcac
gacatcgcgttccacgccttcctgcaatggcaggccgcgcgcgggctcgcggccgcgcaa
cgcgccgcgcgcggccgcggcatggcgatcggcctgatcgcggacttgccggtcggctgc
gacgcggcgggcagcgacgcgtggcgggacggcgatgcgatgctgcgcggcctgtcgatc
ggcgcgcccgccgatccgttcaacgcgcgcggccaggcatggggcgtcaccacgtggacg
ccgacggcgctgcgcgcgcggggcttcgcgccgttcgtcgaatgtctgcgcgcgggcttc
gcgcacgcgggaggcgttcgcatcgatcacgtgctcggcctcgcgcggctgtgggtggtg
cgcgacggcgcgccgccgcgcgacggcgcgtacctgcgctatccgcgcgacgatttgctg
cggctcgccgcgctcgaatcgttccggcatcgcgcgatcgtcatcggcgaggatctcggc
accgtgccggcggatttccgcgcgcggatcgccgcgcgcggcatcgtcggcctgcgcgcg
ctctggttcgaacgggacccggcgggcgcgttccgcgcgccgggcgattgggatcgtcac
gcggccgcgacgagctcgacgcacgatctgccgacggtcgcgggctggtggcgcggcgtc
gatctcggctggcgatggcacgcggccgcctccgcctcggcctgcgcgcccgcgtcctcc
ctctctcccgcctccgacgccgaggccgaggcgaacgccccgcccgcgcggcccggcgaa
tcggaggtcgccgggccggatgcgctgccgcccgaggtgcgcgacatgcgccgcgccgag
cgcgcggcgctctggcgcgcgctgcagcaagccggcgtcgccgcgcgcgggcaaaagatg
ccgccgcgggatgcgccccccgtcggtgcgatactcgcgtacgtcgcgcaagcgcccgcg
ccgctcgcgatctttccgctcgaggatctgctcgcgctcgagggccagccgaacgtgccg
ggcccgccgtgcgggcacccgaactggcggcggcgcatgccgcgctccgtcgacgcgctg
ttcgacgcgccggcgcgcacgcgcatcgccgccgtgcggcgcgcgaggaagcgcgcgcga
tga

DBGET integrated database retrieval system