KEGG   Burkholderia mallei NCTC 10229: BMA10229_A0554Help
Entry
BMA10229_A0554    CDS       T00471                                 

Gene name
acsA-2
Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMA10229_A0554 (acsA-2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMA10229_A0554 (acsA-2)
   00620 Pyruvate metabolism
    BMA10229_A0554 (acsA-2)
   00640 Propanoate metabolism
    BMA10229_A0554 (acsA-2)
  Energy metabolism
   00680 Methane metabolism
    BMA10229_A0554 (acsA-2)
Enzymes [BR:bml01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BMA10229_A0554 (acsA-2)
Lipid biosynthesis proteins [BR:bml01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BMA10229_A0554 (acsA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:578533..580158
Genome map
AA seq 541 aa AA seqDB search
MLPHAAHYAELVERFAWRVPAHYNIGVDACDKWADGSGRLALIHEHAHGVVARYTFDELR
SSSNRLANSFARAGVKRGDRIGILLAQGPETAIAHLAAYKLGAIAVPLFTLFGADALEFR
LGDSGAVALVTDRAGYEKIAPLHASLPSLATIYCIDGAPDLAEPGVLAFDAALAAESDTF
RPADTSADDPALIIYTSGTTGKPKGALHAHRVLLGHLPGVEMSQNLFPARARLFWTPADW
AWIGGLLDVLLPSLHHGVPVLARRFEKFGGAAAFDLLARHGVTHAFLPPTALKLMRAAVA
RPRERYALALESVASGGESLGAELVSWGRDAFGVTINEFYGQTECNVVLSSCSALFEPRA
GTIGKAAPGHRVAIVDDAGNALPPGVTGNIGVRAPDPVMFIGYWRRPEATREKFAGDFLL
TGDLGIADADGFIRFVGRNDDVITSAGYRIGPGPIEDCLLEHPAVRMAAVVGVPDAVRTE
IVKAFVVLNAGYEGSAALARELQTHVKTRLAAHEYPRALAFVDSLPMTATGKIIRRALRD
T
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgctgccccacgccgcccattacgccgagctcgtcgagcgcttcgcctggcgggttccc
gcgcactacaacatcggcgtcgacgcgtgcgacaaatgggccgatggcagcggccgcctc
gcactgatccacgaacacgcgcacggcgtcgtcgcacgttacacgttcgacgaactgagg
agcagctctaatcgactcgcgaacagcttcgcgcgcgcaggcgtgaagcgcggcgaccgc
atcggcatcctcctcgcgcaaggcccggaaacggcgatcgcccatctggccgcatacaag
ctcggcgcgatcgcggtgccgctcttcacactcttcggcgcggacgcgctcgaattccgc
ctcggcgatagcggcgccgtcgcgctcgtcaccgatcgcgccggttacgagaaaatcgcg
ccgctgcatgcgtcgctgccgtcgctcgcgacgatctactgcatcgacggcgcgcccgat
ctcgccgagcccggcgtgctcgcgttcgatgcggcgctcgcggccgaatcggacacgttc
cggccggcggacacgtcggccgacgatccggcgctcatcatctacacgtccggcacgacg
ggcaaaccaaagggcgcgctgcacgcgcatcgggtgctgctcggccatctgcccggcgtc
gagatgtcgcagaacctgtttccggcgcgtgcgcgcctgttctggacgcccgccgattgg
gcatggatcggcgggctgctcgacgtcctgctgccgtcgctgcaccacggcgtgccggtc
ctcgcgcgacgcttcgagaaattcggcggggcggccgcgttcgatctgctcgcccggcac
ggcgtgacgcacgcgttcctgccgccgaccgcgctgaagctgatgcgcgcggctgtcgcg
cggccgcgtgaacgttacgcgctcgcgctcgaatcggtagcgagcggcggcgaatcgctc
ggcgccgaactcgtttcctggggccgcgacgcgttcggcgtgacgatcaacgagttctac
ggacagaccgaatgcaacgtcgtgctgtcgtcgtgcagcgcgctgttcgagccgcgcgcg
gggacgatcggcaaggcggcgcccgggcatcgcgtcgcgatcgtcgacgatgccggcaac
gcgctgccgcccggcgtcacgggcaacatcggcgtgcgcgcgcccgaccccgtgatgttc
atcggctactggcgcaggcccgaggcgacgcgcgagaagttcgccggcgacttcctgctg
acgggcgacctcggcatcgccgacgccgacggtttcatccgcttcgtcggccgcaacgac
gacgtgatcacgagcgccggctaccggatcgggccgggaccgatcgaggattgcctgctc
gagcatccggcggtgcggatggcggccgtcgtcggcgtgccggacgcggtccgcaccgaa
atcgtcaaggcgttcgtcgtgctgaacgccggctatgaaggaagcgccgcgctcgcccgc
gagctgcaaacgcacgtgaagacacggctcgccgcacacgaatatccgcgcgcgctcgcc
ttcgtcgacagcctgccgatgaccgcgaccggcaagatcatccgccgcgcgctgcgcgac
acctga

DBGET integrated database retrieval system