KEGG   Burkholderia mallei NCTC 10229: BMA10229_A0554Help
Entry
BMA10229_A0554    CDS       T00471                                 

Gene name
acsA-2
Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bml01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bml00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bml00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:bml00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:bml00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:578533..580158
Genome map
AA seq 541 aa AA seqDB search
MLPHAAHYAELVERFAWRVPAHYNIGVDACDKWADGSGRLALIHEHAHGVVARYTFDELR
SSSNRLANSFARAGVKRGDRIGILLAQGPETAIAHLAAYKLGAIAVPLFTLFGADALEFR
LGDSGAVALVTDRAGYEKIAPLHASLPSLATIYCIDGAPDLAEPGVLAFDAALAAESDTF
RPADTSADDPALIIYTSGTTGKPKGALHAHRVLLGHLPGVEMSQNLFPARARLFWTPADW
AWIGGLLDVLLPSLHHGVPVLARRFEKFGGAAAFDLLARHGVTHAFLPPTALKLMRAAVA
RPRERYALALESVASGGESLGAELVSWGRDAFGVTINEFYGQTECNVVLSSCSALFEPRA
GTIGKAAPGHRVAIVDDAGNALPPGVTGNIGVRAPDPVMFIGYWRRPEATREKFAGDFLL
TGDLGIADADGFIRFVGRNDDVITSAGYRIGPGPIEDCLLEHPAVRMAAVVGVPDAVRTE
IVKAFVVLNAGYEGSAALARELQTHVKTRLAAHEYPRALAFVDSLPMTATGKIIRRALRD
T
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgctgccccacgccgcccattacgccgagctcgtcgagcgcttcgcctggcgggttccc
gcgcactacaacatcggcgtcgacgcgtgcgacaaatgggccgatggcagcggccgcctc
gcactgatccacgaacacgcgcacggcgtcgtcgcacgttacacgttcgacgaactgagg
agcagctctaatcgactcgcgaacagcttcgcgcgcgcaggcgtgaagcgcggcgaccgc
atcggcatcctcctcgcgcaaggcccggaaacggcgatcgcccatctggccgcatacaag
ctcggcgcgatcgcggtgccgctcttcacactcttcggcgcggacgcgctcgaattccgc
ctcggcgatagcggcgccgtcgcgctcgtcaccgatcgcgccggttacgagaaaatcgcg
ccgctgcatgcgtcgctgccgtcgctcgcgacgatctactgcatcgacggcgcgcccgat
ctcgccgagcccggcgtgctcgcgttcgatgcggcgctcgcggccgaatcggacacgttc
cggccggcggacacgtcggccgacgatccggcgctcatcatctacacgtccggcacgacg
ggcaaaccaaagggcgcgctgcacgcgcatcgggtgctgctcggccatctgcccggcgtc
gagatgtcgcagaacctgtttccggcgcgtgcgcgcctgttctggacgcccgccgattgg
gcatggatcggcgggctgctcgacgtcctgctgccgtcgctgcaccacggcgtgccggtc
ctcgcgcgacgcttcgagaaattcggcggggcggccgcgttcgatctgctcgcccggcac
ggcgtgacgcacgcgttcctgccgccgaccgcgctgaagctgatgcgcgcggctgtcgcg
cggccgcgtgaacgttacgcgctcgcgctcgaatcggtagcgagcggcggcgaatcgctc
ggcgccgaactcgtttcctggggccgcgacgcgttcggcgtgacgatcaacgagttctac
ggacagaccgaatgcaacgtcgtgctgtcgtcgtgcagcgcgctgttcgagccgcgcgcg
gggacgatcggcaaggcggcgcccgggcatcgcgtcgcgatcgtcgacgatgccggcaac
gcgctgccgcccggcgtcacgggcaacatcggcgtgcgcgcgcccgaccccgtgatgttc
atcggctactggcgcaggcccgaggcgacgcgcgagaagttcgccggcgacttcctgctg
acgggcgacctcggcatcgccgacgccgacggtttcatccgcttcgtcggccgcaacgac
gacgtgatcacgagcgccggctaccggatcgggccgggaccgatcgaggattgcctgctc
gagcatccggcggtgcggatggcggccgtcgtcggcgtgccggacgcggtccgcaccgaa
atcgtcaaggcgttcgtcgtgctgaacgccggctatgaaggaagcgccgcgctcgcccgc
gagctgcaaacgcacgtgaagacacggctcgccgcacacgaatatccgcgcgcgctcgcc
ttcgtcgacagcctgccgatgaccgcgaccggcaagatcatccgccgcgcgctgcgcgac
acctga

DBGET integrated database retrieval system