KEGG   Burkholderia mallei NCTC 10229: BMA10229_A0679Help
Entry
BMA10229_A0679    CDS       T00471                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bml00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BMA10229_A0679 (recD)
Enzymes [BR:bml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BMA10229_A0679 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(694465..697161)
Genome map
AA seq 898 aa AA seqDB search
MSVVDERFAWTGGLADRLPEPADFGLALAEGFARRIGMLSRRVGASAAAARWAARAAFAA
SRATAAGHVCVALRALAQRDDEPYDDVRAALAASGVTAFDGIVRGGECPLVVDRDGRLYL
ARYFEYETRLANALVERSRCGGAPAGGADALSPDALGERLVRYFGPQKERGVDWQRVAAL
IALTGRVTIVSGGPGTGKTTTVVGVIACLLDAHPDLRIALAAPTGKAAQRMQEALHARAG
SLPAELAARLPRTSCTLHRLLGGGPGGRFAHHRDNPLPYDLVVVDEASMIDVALAAHLLD
ALAPNARLVLLGDKDQLAAVEAGAVFAELSARPAFSPATCATIARTLGVGEAEFVAALPD
GFVVQAGGAERVADARAAAADMDAAARGTAGAAAAAARTTAAAAARMTTAAAAATGAAPE
SAAQRAPAPHAGRRGGGRASNRTVDDAQGSLFAFDDDAFGGGTSGGEPGAGAQGAGRRDG
GAPSLDGPHAGHRDGGASPGVAHSRRDAFDARARSGSADVSDLENAARAYAPAGAAGPAD
SPADASFVEPAAWIEADELAWLDNAVFSFSEGASANAEADGRRSAAATATDAGARTAPPV
AREATAPTPRETARSDGSAVAPLTDCVVWLERNYRFGLDSPIGRLSLAIRRGAVQDALDA
LSTQDDAAARFSDDGGATLSAATVEQLARGFAGYAAALRDALATPEPDALPLFDVLNRFR
VLCATRTGARGAEEVNARMAAEVRRAVRVPLALGAHWFAGRPVMVTRNDYALGLFNGDIG
IALPGARGALRVWFRGADGRARAVSPAALPPHDTAFALTVHKSQGSEFDDAALILPASFN
RVLSRELVYTAITRARARVQVIGSRAVLALAIATRTARDSGLAARIADALRARQEGAR
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtggtcgacgaacgtttcgcgtggacgggcggcctggcggaccgtctgcccgag
ccggccgatttcgggctcgcgctcgccgaaggcttcgcgcgccggatcgggatgctgtcg
cggcgtgtcggcgcgagcgccgcggccgcgcgctgggcggcacgcgcggcgttcgccgcg
agccgcgcgacggcggcggggcacgtatgcgtcgcgctgcgcgcgctcgcgcagcgcgac
gacgagccgtacgacgacgtacgcgcggcgctcgccgcgagcggcgtgaccgcgttcgac
ggcatcgtgcgcggcggcgagtgcccactcgtcgtcgatcgcgatggtcggctgtatctc
gcgcgctacttcgaatacgagacgcggctcgcgaacgcgctcgtcgagcggagccgatgc
ggcggcgcgccggcgggcggcgccgatgcgctctcgcccgacgcgctcggcgagcggctc
gtccgctatttcgggccgcagaaggagcggggcgtcgattggcagcgcgttgcggccctc
atcgcgctcacgggccgcgtgacgatcgtgagcggcgggccgggcaccggcaagacgacg
acggtcgtcggcgtgatcgcgtgcctgctcgatgcgcatccggacttgcggatcgcgctt
gccgcgcccaccggcaaggccgcgcagcggatgcaggaggcgctgcacgcgcgcgccggc
agcctgccggcggaactcgcggcgcgcctgccgcgcacgtcctgcacgctgcaccggctg
ctgggcggtggcccgggcgggcgcttcgcgcaccaccgcgacaatccgctgccgtacgat
ctcgtcgtcgtcgacgaggcttcgatgatcgacgtcgcgctcgccgcgcatttgctcgac
gcgctcgcgccgaacgcgcgcctcgtgctgctcggcgacaaggatcagctcgcggccgtc
gaggcgggcgcggtgttcgccgagctgagcgcgcgtcccgcgttcagcccggcgacgtgc
gcgacgatcgcgcgcacgctcggcgtcggcgaggccgagttcgtggcggcgctgccggac
gggttcgtcgtgcaggcgggcggcgcggagcgcgtggcggacgcgcgtgcggcagcggcc
gatatggacgcggccgcgcgcgggacggccggcgccgcagctgcggccgcacgaacgacc
gcggccgcagccgcacgaatgaccacggccgcagccgcggcgacgggggccgcgccggaa
tccgccgcgcaacgcgcgccggcgccgcacgcgggccggcgcggcggcgggcgcgcatcg
aatcggaccgtcgacgatgcgcagggatcgttgttcgcgttcgacgacgacgcattcggt
gggggcacgtcgggcggcgagccgggggccggcgcgcaaggtgccgggaggcgagatggc
ggggcgccgagcctcgacgggccgcacgccgggcatcgggacggcggcgcatcgcccggc
gtcgcgcacagccggcgcgatgcgttcgacgcgcgtgcccggtcgggttcggcggatgtt
tccgacctggaaaacgccgcgcgcgcgtacgcgccggcgggcgcagccggcccggccgat
tcgccggcggacgcgtctttcgtcgagccggccgcgtggatcgaagcggacgaactcgcg
tggctcgacaacgcggtcttttcgttctccgaaggcgcttcggcgaatgccgaagccgac
gggcggcgaagcgccgcggcgacggcgaccgacgcgggcgcgcgcaccgcgccgccggtt
gcgcgggaagcgacggcgccgacgccgcgcgagaccgcgcgatcggacggttccgccgtc
gcgccgctgaccgactgcgtcgtctggcttgaacgcaactatcgcttcggccttgattcg
ccgatcggccggctgtcgcttgcgattcgccgcggcgcggtgcaggacgcgctcgacgcg
ctatcgacgcaagacgacgcggccgcgcgttttagcgacgacggcggtgcgacgctgtcg
gccgcgacggtcgagcagctcgcgcgaggcttcgccggctatgcggccgcgctgcgcgac
gcgctggcgacgcccgaacccgatgcgctgccgctcttcgacgtgctcaaccgctttcgc
gtgctttgcgcgacgcgcacgggcgcgcgcggcgcggaggaagtcaacgcgcgcatggcg
gccgaggtgcgccgcgcggtgcgcgtgccgctcgcgctcggtgcgcactggttcgccgga
cggcccgtgatggtgacgcgcaacgattacgcgctcggcctcttcaacggcgacatcggc
attgcgctgcccggcgcgcgcggtgcgctgcgcgtctggtttcgcggcgcggacggccgc
gcccgggcggtgtcgcccgccgcgctgccgccgcacgacacggcgttcgcgctgaccgtc
cacaaatcgcagggctcggaattcgacgacgcggcactgatcctgcccgcgtcgttcaat
cgcgtgctgtcgcgcgaactcgtctacaccgcgatcacgcgcgcgcgcgcgcgcgtgcag
gtgatcggctcgcgcgcggtgctcgcgctcgcgatcgcgacgcgcacggcgcgcgattcc
ggccttgccgcacgaatcgccgatgcgctgcgcgcgcggcaggagggcgcgcgatga

DBGET integrated database retrieval system