KEGG   Burkholderia mallei NCTC 10229: BMA10229_A0740Help
Entry
BMA10229_A0740    CDS       T00471                                 

Gene name
tpiA
Definition
(GenBank) triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
bml00010  Glycolysis / Gluconeogenesis
bml00051  Fructose and mannose metabolism
bml00562  Inositol phosphate metabolism
bml00710  Carbon fixation in photosynthetic organisms
bml01100  Metabolic pathways
bml01110  Biosynthesis of secondary metabolites
bml01120  Microbial metabolism in diverse environments
bml01130  Biosynthesis of antibiotics
bml01200  Carbon metabolism
bml01230  Biosynthesis of amino acids
Module
bml_M00002  Glycolysis, core module involving three-carbon compounds
bml_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMA10229_A0740 (tpiA)
   00051 Fructose and mannose metabolism
    BMA10229_A0740 (tpiA)
   00562 Inositol phosphate metabolism
    BMA10229_A0740 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    BMA10229_A0740 (tpiA)
Enzymes [BR:bml01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BMA10229_A0740 (tpiA)
Exosome [BR:bml04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BMA10229_A0740 (tpiA)
  Exosomal proteins of bladder cancer cells
   BMA10229_A0740 (tpiA)
  Exosomal proteins of melanoma cells
   BMA10229_A0740 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABN02069
UniProt: A2S461
Position
I:complement(759715..760515)
Genome map
AA seq 266 aa AA seqDB search
MNTTPGFGASTTRQTMSKQRIKRVIGNWKMHGRLSGNEALLDEVAQGAQAVPEHVGIGVC
VPFPYLAQARARLHGGRVAWGAQDVSAHEQGAFTGEVAAGMVAEFGAAYAIVGHSERRAY
HGESNEIVAAKAQRALAAGLTPVVCVGETLAEREAGATEQVVGVQLDAVLAVLSQDEAAR
IVVAYEPVWAIGTGRSATAEQAQQVHAFLRGRLAAKGAERVSLLYGGSVKADNAAELFGQ
PDIDGGLIGGASLKSGDFLAICRAAQ
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgacgcccggcttcggcgcgtccacgacgagacaaacgatgtcgaaacaaaga
atcaagcgggtgatcggcaactggaagatgcacggtcgcctgagcggcaacgaggcgctg
ctcgacgaagtcgcgcagggcgcgcaagccgtgcccgagcacgtcggcatcggcgtgtgc
gtgccgtttccgtatctcgcgcaggcgcgggcccggcttcacggcggtcgcgtcgcgtgg
ggcgcgcaggacgtatctgcgcacgagcagggcgcctttaccggcgaagtcgcggccggc
atggtcgcggagttcggcgcggcgtacgcgatcgtcgggcactcggagcgccgcgcgtat
cacggcgaatcgaacgagatcgtcgcggcgaaggcgcaacgtgcgctcgccgcggggctg
acgcccgtcgtgtgcgtcggcgagacgctcgccgagcgcgaagcgggggcgaccgagcag
gtcgtcggcgtgcagctcgacgcggtgctcgcggtgctgtcgcaggacgaggcggcgcgc
atcgtcgtcgcgtacgagcccgtatgggcgatcggcacgggccgcagcgcgacggcggag
caggcgcagcaggtgcacgcgttcctgcgcgggcggctcgcggcgaagggcgccgagcgc
gtgtcgctgctgtatggcggcagcgtgaaggccgacaacgcggccgagctgttcggccag
cctgacatcgacggcggcctgatcggcggcgcgtcgttgaagagcggggatttcctggcg
atttgccgggcggcgcagtaa

DBGET integrated database retrieval system