KEGG   Burkholderia mallei NCTC 10229: BMA10229_A0868Help
Entry
BMA10229_A0868    CDS       T00471                                 

Definition
(GenBank) class II aldolase/adducin domain protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
bml00051  Fructose and mannose metabolism
bml01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bml00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BMA10229_A0868
Enzymes [BR:bml01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     BMA10229_A0868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ABN01588
UniProt: A2S4I9
Position
I:891761..892543
Genome map
AA seq 260 aa AA seqDB search
MVDTLKMGKAELVALAQRRLDNEIKDSGWSAREKLALTCRILFDDGHDSGLAGQITCRAD
APHTYYTQRLGLGFDEIAESNLLQVDQDLEVIGGQGIPNPANRFHTWIYRARPDVNCIIH
THPTHVAALSMLETPLVVSHMDTCPLHGDCAFLKDWPGVPVGNEEGEIISNALGDKRAIL
LSHHGQLVVGKTIEEACMLAILIERAARLQLLAIAAGAIAPIPPALAADAHDWISTPKRD
AVTFAYYARRALRRHPDCLD
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacacattgaagatgggcaaggccgagctcgtcgcgctcgcgcagcggcggctc
gacaacgagatcaaggacagcgggtggagcgcgcgcgagaagctcgcgctcacctgccgg
atcctgttcgacgacgggcacgactccggcctcgccgggcagatcacgtgccgcgccgac
gcgccgcacacgtactacacgcagcgcctcgggctcggcttcgacgagatcgccgaatcg
aacctgctgcaggtcgatcaggatctcgaggtcatcggcggccagggcattccgaatccc
gcgaaccgctttcacacgtggatttatcgcgcgcgccccgacgtcaactgcatcatccac
acgcacccgacgcacgtcgccgcgctgtcgatgctcgagacgccgctcgtcgtgtcgcac
atggacacctgtccgcttcacggcgactgcgcgttcctgaaggattggccgggcgtgccc
gtcggcaacgaggaaggcgagatcatctcgaacgcgctcggcgacaagcgcgcgatcctg
ctgtcgcatcacggccagctcgtcgtcggcaagacgatcgaagaggcgtgcatgctcgcg
atcctgatcgagcgcgcggcgcggctgcaactgctcgcgatagcggccggcgcgatcgcg
ccgattccgcccgcgctcgcggccgacgcgcacgactggatctcgacgcccaagcgcgac
gcggtgaccttcgcgtactacgcgcgccgcgcgctacgccgccaccccgactgcctcgac
tga

DBGET integrated database retrieval system