KEGG   Burkholderia mallei NCTC 10229: BMA10229_A0903Help
Entry
BMA10229_A0903    CDS       T00471                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bml00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:bml00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:924210..924713
Genome map
AA seq 167 aa AA seqDB search
MTTLTLIVARARNGVIGRDNRLPWKLPEDLAFFKRTTMGAPIVMGRKTHESIGRPLPGRR
NIVVTRDAARRFDGCDTVTSLDDALALAARDGAAEAFLIGGAQLYEEGLRHADKLIVTEI
DQDFEGDASFPAPDPAQWEAVSRDAHRAAQPNDFTYAFVVYRRRRAG
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgctgaccttgatcgtcgcgcgcgcccgcaacggcgtgatcggccgcgacaac
cgacttccgtggaaactccccgaggacctcgcgttcttcaagcgcacgacgatgggcgcg
ccgatcgtgatgggccgcaagacgcacgaatcgatcggccggccgctgccggggcgccgc
aacatcgtcgtcacgcgcgacgccgcgcgccgcttcgacggctgcgacacggtcacctcg
ctcgacgacgcgctcgcgctcgccgcgcgcgacggcgcggccgaagcgttcctgatcggc
ggcgcgcaactgtacgaggaaggcctgcgccacgcggacaagctgatcgtcaccgaaatc
gatcaggatttcgaaggtgacgcgtcgttccccgcgcccgatcccgcgcaatgggaagcc
gtgtcgcgcgacgcgcaccgcgcggcgcagcccaacgatttcacgtacgcgttcgtcgtc
tatcgccgcaggcgcgccggctga

DBGET integrated database retrieval system