KEGG   Burkholderia mallei NCTC 10229: BMA10229_A1093Help
Entry
BMA10229_A1093    CDS       T00471                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bml00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BMA10229_A1093 (folK)
Enzymes [BR:bml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     BMA10229_A1093 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1116241..1116768
Genome map
AA seq 175 aa AA seqDB search
MTVAYLGLGANLGDARQALKDAVVCLAQQHAITVLGKSSLYRTAPVDASGGDYYNCVVKI
DTVLAARALLALCQKIEHHFGRERPYRNAPRTLDIDILLYGELTIDEPDLVVPHPRLTER
AFALVPLVEIEPALAIPARGRADGFLADVAHQRIEKVQTCQCLAMRAAAEKNRCR
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgacggttgcttatctcgggttgggggccaatctcggcgacgcgcgccaggccttgaag
gacgcagtggtctgcctcgcccagcagcacgccatcacggtgctcggcaagtcgagcctg
tatcgcaccgcgcccgtcgacgcgagtggcggcgattactacaactgcgtcgtgaagatc
gacacggtgctcgccgcgcgcgcgctcctcgcgctgtgccagaagatcgagcaccacttc
ggccgcgagcggccgtaccgaaacgcgccgcgcacgctcgacatcgacatcctgctctac
ggtgaactgacgatagacgaacccgacctcgtcgttccgcatccgcgcctgaccgagcgc
gcgttcgcgctcgtgccgctcgtcgagatcgagccggcgctcgcgattcccgcacgcggc
cgcgccgacggattcctcgccgacgtcgcgcaccagcgcatcgagaaggtccagacctgc
cagtgcctcgcgatgcgggccgccgccgaaaagaaccgttgccgatga

DBGET integrated database retrieval system