KEGG   Burkholderia mallei NCTC 10229: BMA10229_A1445Help
Entry
BMA10229_A1445    CDS       T00471                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bml00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:bml00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1469665..1472166
Genome map
AA seq 833 aa AA seqDB search
MNRISHSLCAALLAAATLLPTASRAQLPARPTAGAGAPATAAPVRPASTPAELAARLANG
LAVRVAVDNNHAASAGVPCADLGADWASCATGRLILQNRGHSPLTDGGWKLYLHSIRRLL
RIDRPGFTLRHLTGDLYELTPQPGTVRLAQGERIELPFVAEYWLRRYSDVTPRPYVVVDG
AAPAVLRYDDTDDELRYVETLPADAQNNSPGNAPPAAAQPVANRALPSVKRQRALPGALD
LRGVELTLPELPSAQVAALRERAGTLGLDGARVPVWGVVAPRRLPADIAVPGGYRLAIGP
RGAFIEGADRAGLYYGVQTLFSLVPAGGATVPAMLIEDAPRFTHRGMHVDLARNFKPPAT
LRRLIDQMSAYKLNRLHLHLSDDEGWRIEIPGLPELTDVGARRCHDPSETRCLLPQLGSG
PDDRSGGGYLTRDDYVALLRYAAERFVEVIPEIDMPAHSRAAVVSMEARYRRLHAAGRER
EANAYRLLDAQDTSNLLTVQFYDRRSDLNPCMPGALNFASKVIREIASMHADAQAPLRIW
HFGGDEAKNILLGAGFQPLDGADPGKGRVDLAAQDKPWARSPACTALLRRGEIKSIDELP
TRFAKQVSAIVNANGIGTMAAWQDGIKHASGPREFSTRHVMVSLWDTIFWGASDSARDLS
AKGYRTVLALPDYLYFDFPYTRNPRERGYYWGSQATDEYKVFSLAPENLPQNAEVFGDRD
GNPFEVTSAGAAPSIEGIQGQAWGEVMRNGQLLEYMVYPRLLALAERAWHKADWELPYAA
GVRYKLGDTHHVDTAALERDWAGFATVLKQRELPKLERADIGYRKPTFTLTGE
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaatctcgcattccctgtgcgccgcgctattggccgccgcgacgctgttgccc
acggcctcgcgcgcgcaactgcccgcgcgccccacggccggcgcgggcgcgcccgcgacg
gccgcgcccgtgcggcccgcgtccacgccggccgagctcgccgcgcggctcgccaacggc
ctcgcggtgcgcgtggccgtcgacaacaatcacgcggcatcggccggcgtgccgtgcgcc
gacctcggcgcggactgggcgagctgcgcgacgggccgcctgatcctgcagaatcgcggc
cactcgcccctcaccgacggcggctggaagctctatctgcacagcatccgccggctgctc
cgaatcgaccgccccggcttcacgctgcgccatctgacgggcgatctatacgagctgacg
ccgcagcccggcacggtaaggctcgcgcagggcgagcgcatcgagctgccgttcgtcgcc
gaatactggctgcgccgctacagcgacgtgaccccgcgcccgtacgtggtcgtcgacggc
gcggcgcccgcggtgctgcgctacgacgataccgacgacgagctgcgctacgtcgaaacg
ctgcccgccgacgcgcagaacaactcgcccggcaatgcgccgcccgccgccgcgcagccg
gtggcgaaccgcgcgctgccgagcgtgaagcggcagcgcgcgctgcccggcgcgctcgat
ctgcgcggcgtcgagctgacgctgccggagctgccgtccgcgcaggtcgcggcgctgcgc
gaacgcgcgggcacgctcggcctggacggcgcgcgcgtgccggtgtggggcgtcgtcgcg
ccgcgccggctgcccgccgacatcgcggtgccgggcggctaccggctcgcgatcggcccg
cgcggcgcgttcatcgagggggccgatcgcgcgggcctctactacggcgtgcagacgctc
ttctcgctcgtgccggccggcggcgcgacggtgcccgcgatgctgatcgaagacgcgccg
cgcttcacgcaccgcgggatgcacgtcgatctcgcgcgcaacttcaagccgcccgccacg
ctgcgccggctgatcgaccagatgagcgcgtacaagctcaaccggctgcatctgcacctg
tccgacgacgagggctggcgcatcgagattcccggcctgcccgagctgaccgacgtcggc
gcgcgccgctgccacgacccgagcgagacgcgctgcctgctgccgcagctcggctcgggg
cccgacgatcgttcgggcggcggctacctgacgcgcgacgactacgtcgcgctgctgcgc
tacgcggccgagcgcttcgtcgaagtgatccccgagatcgacatgcccgcgcactcgcgc
gcggccgtcgtatcgatggaggcgcgctatcgccgcctgcacgcggcgggccgcgagcgg
gaagcgaacgcgtatcggctgctcgatgcgcaggacacgtcgaacctgctgaccgtgcag
ttctacgaccggcgcagcgatctgaacccgtgcatgccgggcgcgctgaacttcgcgtcg
aaggtgatccgcgagatcgcgtcgatgcacgcggacgcgcaagcgccgctgcggatctgg
cacttcggcggcgacgaggcgaagaacatcctgctcggcgcgggcttccagccgctcgac
ggcgccgatcccggcaagggccgcgtcgatctcgccgcgcaggacaagccgtgggcgcgc
tcgcccgcctgtacggcgctgcttcggcgcggcgagatcaaatcgatcgacgaattgccg
acgcgcttcgcgaagcaggtcagcgcgatcgtgaacgcgaacggaatcggcacgatggcc
gcgtggcaggacggcatcaagcacgcgagcgggccgcgggagttcagcacgcggcacgtg
atggtgtcgctgtgggacaccatcttctggggcgcgtccgacagcgcgcgcgatctgagc
gcgaagggctaccggaccgtgctcgcgctgcccgattacctgtacttcgatttcccgtac
acgcgcaatccgcgcgagcgcggctattactggggctcgcaggcgacggacgagtacaag
gtgttctcgctcgcgccggagaacctgccgcagaacgccgaggtgttcggcgatcgcgac
ggcaacccgttcgaggtgacgagcgcaggcgcggcgccgagcatcgagggcatccagggg
caggcgtggggcgaggtgatgcgcaacgggcaactgctcgaatacatggtgtatccgcgc
cttctcgcgctcgccgagcgcgcgtggcacaaggccgactgggaactgccctacgcggcc
ggcgtgcgctacaagctcggcgacacgcatcacgtcgacacggccgcgctcgagcgcgac
tgggcgggcttcgcgacggtgctcaagcagcgcgaactgccgaagctcgagcgtgcggac
atcgggtatcgcaagccgacgtttacgctgacgggcgaatga

DBGET integrated database retrieval system