KEGG   Burkholderia mallei NCTC 10229: BMA10229_A1689Help
Entry
BMA10229_A1689    CDS       T00471                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bml02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bml02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1730288..1731382
Genome map
AA seq 364 aa AA seqDB search
MQKKIKVLCVDDSALIRSLMTEIINSQPDMEVCATAPDPLVARELIKQHNPDVLTLDVEM
PRMDGLDFLEKLMRLRPMPVVMVSSLTERGSEITLRALELGAVDFVTKPRVGIRDGMLDY
SEKLADKVRAASRARVRQNPQPHAAAAAAAHGHAGAAAPLINNPLVSTEKLIIVGASTGG
TEAIREVLTPLPPDAPAVLIAQHMPPGFTRSFAQRLNGLCRISVKEAEHGERVLPGHAYI
APGHAHLLLARSGANYIAHLSDEPPVNRHRPSVDVLFRSAAQHAGKNALGVILTGMGRDG
AAGLLEMKKAGAYTFAQDEASCVVFGMPREAIAMGGVDDVAPLSDMSRRIMARLASMGDR
VQRV
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaagaaaatcaaagtgctgtgcgtcgacgattcggcgctgatccgcagcctgatg
acagaaatcatcaacagccagcccgacatggaagtgtgcgcaacggcgcccgatccgctc
gtggcgcgcgagctgatcaagcagcacaacccggacgtgctgacgctcgacgtcgaaatg
ccgcggatggacgggctcgacttccttgaaaagctgatgcgcctgcggccgatgccggtc
gtgatggtgtcgtcgctcaccgagcgcggctcggagatcacgctgcgcgcgctcgagctg
ggcgcggtcgatttcgtgacgaagccgcgcgtcgggattcgcgacggcatgctcgactat
tcggaaaagctggccgacaaggtgcgcgcggcatcgcgcgcgcgcgtgcggcagaatccg
cagccgcatgcggcggccgccgcggccgcgcacggccacgcgggcgccgccgcgccgctc
atcaacaatccgcttgtcagtaccgagaagctgatcatcgtcggcgcgtccacgggcggc
accgaggcgatccgcgaagtgctgacgccgctgccgcccgatgcgcccgccgtgctgatc
gcgcagcacatgccgcccggcttcacgcgctcgttcgcgcagcgcctgaacgggctgtgc
cggatctcggtgaaggaggcggagcacggcgagcgcgtgctgccggggcacgcgtatatc
gcgcccggccacgcgcacctgctgctcgcgaggagcggcgcgaactacatcgcgcacctg
tcggacgagccgcccgtcaatcgtcatcgcccgtcggtcgacgtgctgttccgctcggcc
gcgcagcatgcgggcaagaacgcgctcggcgtgatcctgacgggcatgggccgcgacggc
gcggccgggctgcttgaaatgaaaaaggccggcgcgtatacatttgcgcaggacgaggcg
agctgcgtcgtgttcggaatgccgcgcgaggcgatcgcgatgggcggcgtcgacgacgtc
gcgcccctttccgacatgagtcgccgtatcatggcgcgcctcgcgtcgatgggcgatcgc
gtgcagcgcgtgtga

DBGET integrated database retrieval system