KEGG   Burkholderia mallei NCTC 10229: BMA10229_A1689Help
Entry
BMA10229_A1689    CDS       T00471                                 

Gene name
cheB
Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:bml00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BMA10229_A1689 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    BMA10229_A1689 (cheB)
Enzymes [BR:bml01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     BMA10229_A1689 (cheB)
Two-component system [BR:bml02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   BMA10229_A1689 (cheB)
Bacterial motility proteins [BR:bml02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    BMA10229_A1689 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:1730288..1731382
Genome map
AA seq 364 aa AA seqDB search
MQKKIKVLCVDDSALIRSLMTEIINSQPDMEVCATAPDPLVARELIKQHNPDVLTLDVEM
PRMDGLDFLEKLMRLRPMPVVMVSSLTERGSEITLRALELGAVDFVTKPRVGIRDGMLDY
SEKLADKVRAASRARVRQNPQPHAAAAAAAHGHAGAAAPLINNPLVSTEKLIIVGASTGG
TEAIREVLTPLPPDAPAVLIAQHMPPGFTRSFAQRLNGLCRISVKEAEHGERVLPGHAYI
APGHAHLLLARSGANYIAHLSDEPPVNRHRPSVDVLFRSAAQHAGKNALGVILTGMGRDG
AAGLLEMKKAGAYTFAQDEASCVVFGMPREAIAMGGVDDVAPLSDMSRRIMARLASMGDR
VQRV
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaagaaaatcaaagtgctgtgcgtcgacgattcggcgctgatccgcagcctgatg
acagaaatcatcaacagccagcccgacatggaagtgtgcgcaacggcgcccgatccgctc
gtggcgcgcgagctgatcaagcagcacaacccggacgtgctgacgctcgacgtcgaaatg
ccgcggatggacgggctcgacttccttgaaaagctgatgcgcctgcggccgatgccggtc
gtgatggtgtcgtcgctcaccgagcgcggctcggagatcacgctgcgcgcgctcgagctg
ggcgcggtcgatttcgtgacgaagccgcgcgtcgggattcgcgacggcatgctcgactat
tcggaaaagctggccgacaaggtgcgcgcggcatcgcgcgcgcgcgtgcggcagaatccg
cagccgcatgcggcggccgccgcggccgcgcacggccacgcgggcgccgccgcgccgctc
atcaacaatccgcttgtcagtaccgagaagctgatcatcgtcggcgcgtccacgggcggc
accgaggcgatccgcgaagtgctgacgccgctgccgcccgatgcgcccgccgtgctgatc
gcgcagcacatgccgcccggcttcacgcgctcgttcgcgcagcgcctgaacgggctgtgc
cggatctcggtgaaggaggcggagcacggcgagcgcgtgctgccggggcacgcgtatatc
gcgcccggccacgcgcacctgctgctcgcgaggagcggcgcgaactacatcgcgcacctg
tcggacgagccgcccgtcaatcgtcatcgcccgtcggtcgacgtgctgttccgctcggcc
gcgcagcatgcgggcaagaacgcgctcggcgtgatcctgacgggcatgggccgcgacggc
gcggccgggctgcttgaaatgaaaaaggccggcgcgtatacatttgcgcaggacgaggcg
agctgcgtcgtgttcggaatgccgcgcgaggcgatcgcgatgggcggcgtcgacgacgtc
gcgcccctttccgacatgagtcgccgtatcatggcgcgcctcgcgtcgatgggcgatcgc
gtgcagcgcgtgtga

DBGET integrated database retrieval system