KEGG   Burkholderia mallei NCTC 10229: BMA10229_A2401Help
Entry
BMA10229_A2401    CDS       T00471                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
bml00020  Citrate cycle (TCA cycle)
bml00640  Propanoate metabolism
bml00660  C5-Branched dibasic acid metabolism
bml01100  Metabolic pathways
bml01110  Biosynthesis of secondary metabolites
bml01120  Microbial metabolism in diverse environments
bml01130  Biosynthesis of antibiotics
bml01200  Carbon metabolism
Module
bml_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bml_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bml00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BMA10229_A2401 (sucC)
   00640 Propanoate metabolism
    BMA10229_A2401 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BMA10229_A2401 (sucC)
Enzymes [BR:bml01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BMA10229_A2401 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABN02132
UniProt: A2S8U3
Position
I:complement(2443413..2444579)
Genome map
AA seq 388 aa AA seqDB search
MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAQELGGPVWVVKAQIHAGGRGKGGGV
KVAKSLEQVREYSNQILGMQLKTHQTGPEGQKVNRLLIEEGADIKKELYVGIVIDRVSQK
VVVMASSEGGMDIEEVAEKTPEAIHKVAVEPSVGLQDAEADDLAKKIGVPDASIPQAREI
LKGLYKSFWETDASLAEINPLVLTGDGKVIALDAKFNFDSNALFRHPEIVAYRDLDEEDP
AEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATTEKVTE
AFKLMLKNPGLKAILVNIFGGIMRCDVIAEGVIAGSKAVNLNVPLVVRMKGTNEDLGKKM
LAESGLPIISADSMEEAAQKVVAAAAGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgagtaccagggtaaggaaatcctgcggaaattcggagtcgcggtaccg
cgcggcaagccggcgttctcggtggacgaggccgtcaaggtggcgcaagagctgggcggc
ccggtctgggtcgtcaaggcccagattcatgcgggcggccgcggcaagggcggcggcgtg
aaggtcgcgaagtcgctcgagcaagtgcgcgaatactcgaaccagatcctcggcatgcag
ctgaagacgcaccagacgggcccggaaggccagaaggtcaaccgtctgctgatcgaagaa
ggcgcggacatcaagaaggaactgtatgtcggcatcgtgatcgatcgcgtgtcgcagaag
gtcgtcgtgatggcgtcgagcgaaggcggcatggacatcgaggaagtcgcggaaaagacg
ccggaagcgatccacaaggtcgccgtcgagccgtcggtgggcctgcaggatgccgaagcc
gacgatctcgcgaagaagatcggcgtgccggacgcatcgatcccgcaagcgcgcgaaatc
ctgaagggcctgtacaagtcgttctgggaaacggacgcgtcgctcgccgaaatcaacccg
ctcgtgctgacgggcgacggcaaggtgatcgcgctcgacgcgaagttcaacttcgattcg
aacgcgctgttccgccatccggaaatcgtcgcgtaccgcgatctggacgaagaagatccg
gctgaaatcgaagcgtcgaagttcgacctcgcgtacatctcgctcgacggcaacatcggc
tgcctcgtgaacggcgcgggcctggcgatggcgacgatggatacgatcaagctgttcggc
ggcgagccggcgaacttcctcgacgtcggcggcggcgcgacgaccgagaaggtcaccgaa
gcgttcaagctgatgctgaagaacccgggcctgaaggcgatcctcgtgaacatcttcggc
ggcatcatgcgctgcgacgtgatcgcggaaggcgtgatcgcgggctcgaaggccgtgaac
ctgaacgtgccgctcgtcgtgcgcatgaagggcacgaacgaagacctcggcaagaagatg
cttgcggaatccggcctgccgatcatctcggcggacagcatggaagaagcggcgcagaag
gtcgtcgccgcggctgcgggcaagtaa

DBGET integrated database retrieval system