KEGG   Burkholderia mallei NCTC 10229: BMA10229_A2612Help
Entry
BMA10229_A2612    CDS       T00471                                 

Definition
bifunctional glucokinase/RpiR family transcriptional regulator
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMA10229_A2612
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMA10229_A2612
   00052 Galactose metabolism
    BMA10229_A2612
   00500 Starch and sucrose metabolism
    BMA10229_A2612
   00520 Amino sugar and nucleotide sugar metabolism
    BMA10229_A2612
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BMA10229_A2612
   00524 Butirosin and neomycin biosynthesis
    BMA10229_A2612
Enzymes [BR:bml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     BMA10229_A2612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2649691..2651553)
Genome map
AA seq 620 aa AA seqDB search
MADVGGTNARFALETGPGEITQIRVYPGAEYPTLTDAIRKYLKDAKIGRVNHAAIAIANP
VDGDQVRMTNHNWSFSIEATRRALGFDTLLVVNDFTALAMALPGLTDAQRVQIGGGTRRQ
NSVIGLMGPGTGLGVSGLIPADDRWIALGSEGGHATFAPMDEREDLVLQYARRKYPHVSF
ERVCAGPGMEIIYRALAARDKKRIAANVDTADIVERAHAGDALALEAVECFCAILGTFAG
NLAVTLGALGGIYIGGGVVPKLGELFMRSPFRARFEAKGRFEAYLANIPTYLITAEYPAF
LGVSAILAEQLSNRTGGASSAVFERIRQMRDALTPAERRVADLALNHPRSIINDPIVDIA
RKADVSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTIPMSHSQVHLGDTATDFGAKVLDN
TVSAILQLREHLNFEHVEQAIDILNNARRIEFYGLGNSNIVAQDAHYKFFRFGIPTIAYG
DLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLDVAMQAGAKVIAITSSNTPLAKRATV
ALETDHIEMRESQLSMISRILHLVMIDILAVGVAIRRAAPNAELAEAMARAKARAGASAG
DEAADVLDWLSHGAAPAAKD
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
ttggccgacgtcggcggcacgaacgcgcgcttcgcgctcgagacgggcccgggagaaatc
acgcagatccgcgtgtacccgggcgccgagtatccgacgctcaccgacgcgatccgcaag
tatctgaaggacgcgaagatcggccgcgtgaatcacgcggcgatcgcgatcgcgaacccc
gtcgacggcgatcaggtccggatgacgaatcacaactggagcttctcgatcgaggcgacg
cgccgcgcgctcggcttcgatacgctgctcgtcgtcaacgatttcaccgcgctcgcgatg
gcgctgcccggcctgaccgatgcgcagcgcgtacagatcggcggcggcacgcgccgacag
aacagcgtgatcggcctgatggggccgggcacggggctcggcgtgtcggggctcattccc
gccgacgaccgctggatcgcgctcggcagcgaaggcggccacgcgacgttcgcgccgatg
gacgagcgcgaggatctcgtgctgcaatacgcgcgccgcaagtatcctcacgtgtcgttc
gagcgcgtatgcgcgggcccgggcatggagatcatctatcgcgcgctcgccgcgcgcgac
aagaagcgtatcgccgcgaacgtcgacacggccgacatcgtcgagcgcgcgcacgcgggc
gatgcgctcgcgctcgaggcggtcgagtgcttctgcgcgattctcggcacgttcgccggc
aacctcgcggtcacgctcggcgcgttgggcggcatctatatcggcggcggcgtcgtgccg
aagctcggcgagctgttcatgcgctcgccgtttcgcgcgcgcttcgaggcgaagggccgc
ttcgaggcgtatctcgcgaacatcccgacctacctgatcaccgcggaatacccggcgttt
ctcggcgtatcggcgatcctcgccgagcaactgtcgaaccgcacgggcggcgcgtcgtcg
gccgtgttcgagcgcatccgccagatgcgcgacgcgttgacgcccgccgagcggcgcgtc
gccgatctcgcgctcaaccatccgcgctcgatcatcaacgatccgatcgtcgacatcgcg
cgcaaggccgacgtgagccagcccaccgtgatccgcttctgccgctcgctcggctgccag
gggctgtcggacttcaagctgaagctcgcgacgggcctcaccggcacgatcccgatgagc
cacagccaggtgcatctgggcgacaccgcgaccgatttcggcgcgaaggtgctcgacaac
acggtatcggcgatccttcagttgcgcgagcatctgaacttcgagcacgtcgagcaggcg
atcgacatcctgaacaatgcgcggcgcatcgagttctacggcctgggcaattcgaacatc
gtcgcgcaggacgcgcactacaagttcttccgcttcgggattccgacgatcgcgtacggc
gacctgtacatgcaggcggcgtcggccgcgctcctcggcaagggcgacgtgatcgtcgcg
gtgtcgaagtcggggcgcgcgccggagctgttgcgcgtgctcgacgtcgcgatgcaggcg
ggcgcgaaggtgatcgcgatcacgtcgagcaacacgccgctcgccaagcgcgcgacggtc
gcgctcgagaccgatcacatcgagatgcgcgagtcgcagttgtcgatgatctcgcggatc
ctgcatctcgtgatgatcgacatcctcgcggtcggcgtcgcgatccgccgcgccgcgccg
aacgcggagctcgcggaggcgatggcgcgcgcgaaggcgcgcgcgggcgcgagcgcgggc
gacgaggccgccgacgtgctcgactggctgagccacggcgcggcgcccgcggcgaaggac
tga

DBGET integrated database retrieval system