KEGG   Burkholderia mallei NCTC 10229: BMA10229_A2612Help
Entry
BMA10229_A2612    CDS       T00471                                 

Definition
bifunctional glucokinase/RpiR family transcriptional regulator
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bml01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bml00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bml00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bml00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bml00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:bml00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(2649691..2651553)
Genome map
AA seq 620 aa AA seqDB search
MADVGGTNARFALETGPGEITQIRVYPGAEYPTLTDAIRKYLKDAKIGRVNHAAIAIANP
VDGDQVRMTNHNWSFSIEATRRALGFDTLLVVNDFTALAMALPGLTDAQRVQIGGGTRRQ
NSVIGLMGPGTGLGVSGLIPADDRWIALGSEGGHATFAPMDEREDLVLQYARRKYPHVSF
ERVCAGPGMEIIYRALAARDKKRIAANVDTADIVERAHAGDALALEAVECFCAILGTFAG
NLAVTLGALGGIYIGGGVVPKLGELFMRSPFRARFEAKGRFEAYLANIPTYLITAEYPAF
LGVSAILAEQLSNRTGGASSAVFERIRQMRDALTPAERRVADLALNHPRSIINDPIVDIA
RKADVSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTIPMSHSQVHLGDTATDFGAKVLDN
TVSAILQLREHLNFEHVEQAIDILNNARRIEFYGLGNSNIVAQDAHYKFFRFGIPTIAYG
DLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLDVAMQAGAKVIAITSSNTPLAKRATV
ALETDHIEMRESQLSMISRILHLVMIDILAVGVAIRRAAPNAELAEAMARAKARAGASAG
DEAADVLDWLSHGAAPAAKD
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
ttggccgacgtcggcggcacgaacgcgcgcttcgcgctcgagacgggcccgggagaaatc
acgcagatccgcgtgtacccgggcgccgagtatccgacgctcaccgacgcgatccgcaag
tatctgaaggacgcgaagatcggccgcgtgaatcacgcggcgatcgcgatcgcgaacccc
gtcgacggcgatcaggtccggatgacgaatcacaactggagcttctcgatcgaggcgacg
cgccgcgcgctcggcttcgatacgctgctcgtcgtcaacgatttcaccgcgctcgcgatg
gcgctgcccggcctgaccgatgcgcagcgcgtacagatcggcggcggcacgcgccgacag
aacagcgtgatcggcctgatggggccgggcacggggctcggcgtgtcggggctcattccc
gccgacgaccgctggatcgcgctcggcagcgaaggcggccacgcgacgttcgcgccgatg
gacgagcgcgaggatctcgtgctgcaatacgcgcgccgcaagtatcctcacgtgtcgttc
gagcgcgtatgcgcgggcccgggcatggagatcatctatcgcgcgctcgccgcgcgcgac
aagaagcgtatcgccgcgaacgtcgacacggccgacatcgtcgagcgcgcgcacgcgggc
gatgcgctcgcgctcgaggcggtcgagtgcttctgcgcgattctcggcacgttcgccggc
aacctcgcggtcacgctcggcgcgttgggcggcatctatatcggcggcggcgtcgtgccg
aagctcggcgagctgttcatgcgctcgccgtttcgcgcgcgcttcgaggcgaagggccgc
ttcgaggcgtatctcgcgaacatcccgacctacctgatcaccgcggaatacccggcgttt
ctcggcgtatcggcgatcctcgccgagcaactgtcgaaccgcacgggcggcgcgtcgtcg
gccgtgttcgagcgcatccgccagatgcgcgacgcgttgacgcccgccgagcggcgcgtc
gccgatctcgcgctcaaccatccgcgctcgatcatcaacgatccgatcgtcgacatcgcg
cgcaaggccgacgtgagccagcccaccgtgatccgcttctgccgctcgctcggctgccag
gggctgtcggacttcaagctgaagctcgcgacgggcctcaccggcacgatcccgatgagc
cacagccaggtgcatctgggcgacaccgcgaccgatttcggcgcgaaggtgctcgacaac
acggtatcggcgatccttcagttgcgcgagcatctgaacttcgagcacgtcgagcaggcg
atcgacatcctgaacaatgcgcggcgcatcgagttctacggcctgggcaattcgaacatc
gtcgcgcaggacgcgcactacaagttcttccgcttcgggattccgacgatcgcgtacggc
gacctgtacatgcaggcggcgtcggccgcgctcctcggcaagggcgacgtgatcgtcgcg
gtgtcgaagtcggggcgcgcgccggagctgttgcgcgtgctcgacgtcgcgatgcaggcg
ggcgcgaaggtgatcgcgatcacgtcgagcaacacgccgctcgccaagcgcgcgacggtc
gcgctcgagaccgatcacatcgagatgcgcgagtcgcagttgtcgatgatctcgcggatc
ctgcatctcgtgatgatcgacatcctcgcggtcggcgtcgcgatccgccgcgccgcgccg
aacgcggagctcgcggaggcgatggcgcgcgcgaaggcgcgcgcgggcgcgagcgcgggc
gacgaggccgccgacgtgctcgactggctgagccacggcgcggcgcccgcggcgaaggac
tga

DBGET integrated database retrieval system