KEGG   Burkholderia mallei NCTC 10229: BMA10229_A2820Help
Entry
BMA10229_A2820    CDS       T00471                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bml00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BMA10229_A2820
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BMA10229_A2820
Enzymes [BR:bml01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BMA10229_A2820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2846306..2847334
Genome map
AA seq 342 aa AA seqDB search
MKLPPGPVMLDVAGTTLTRDDARRLAHPHTGGVILFARHFESRAQLVALTEAIRAIRDGI
LIAVDHEGGRVQRFRTDGFTVLPAMRRLGELWDKDVLHATKAATALGYVLASELRACGID
MSFTPVLDLDYGRSKVIGDRAFHRDPRVVALLAKSVNHGLALAGMANCGKHFPGHGFAQA
DSHVALPTDDRPLDEILANDAAPYDWLGLSLSAVIPAHVIYTQVDSKPAGFSRVWLQDVL
RGRLRFAGAVFSDDLSMEAAREGGTLAQSAQAALEAGCDMVLVCNQPDAAERVLDELRTT
ASRESSRRIKQMRPRGKALEWRKLMREPRYLNAQSLLRSTFA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgccccccggtccggtgatgctcgacgtcgccggcacgacgctcacgcgcgac
gacgcgcgccgcctcgcgcatccgcacacgggcggcgtgatcctgttcgcgcgccacttc
gagagccgcgcgcaactcgtcgcgctgaccgaggcgatccgggcgatccgcgacggcatc
ctgatcgcggtcgatcacgagggcggccgcgtgcagcgctttcgcaccgacggcttcacc
gtgctgccggcgatgcgccggctcggcgagctgtgggacaaggacgtgctgcacgcgacg
aaggcggcgaccgcgctcggctatgtgctcgcttccgagctgcgcgcgtgcggcatcgac
atgagcttcacgcccgtgctcgatctcgattacggccgctcgaaggtgatcggcgatcgc
gcgttccatcgcgatccgcgcgtcgtcgcgttgctcgcgaagagcgtcaaccacgggctc
gcgctcgccgggatggcgaactgcggcaagcattttcccggccacggcttcgcgcaggcc
gattcgcacgtcgcgctgccgaccgacgatcgtccgctcgacgagatcctcgcgaacgac
gcggcgccgtacgactggctcgggctgtcgttgtcggccgtcattccggcgcacgtgatc
tacacgcaagtcgattcgaagccggccggcttctcgcgcgtgtggttgcaggacgtgctg
cgcggccggctgcgctttgcgggcgccgtgttcagcgacgatctgtcgatggaggccgcg
cgcgagggcggcacgctcgcgcagtcggcgcaggccgcactcgaggcgggctgcgacatg
gtgctcgtgtgcaaccagccggatgcggcggagcgggtgctcgacgagctgcgcacgacg
gcgtcgcgcgaatcgtcgcggcggatcaagcagatgcggccgcgcggcaaggcgctcgag
tggcgcaagctgatgcgcgagccgcgctatctgaatgcgcagagcctgttgcgcagcacg
ttcgcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system