KEGG   Burkholderia mallei NCTC 10229: BMA10229_A2820Help
Entry
BMA10229_A2820    CDS       T00471                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bml00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bml00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:2846306..2847334
Genome map
AA seq 342 aa AA seqDB search
MKLPPGPVMLDVAGTTLTRDDARRLAHPHTGGVILFARHFESRAQLVALTEAIRAIRDGI
LIAVDHEGGRVQRFRTDGFTVLPAMRRLGELWDKDVLHATKAATALGYVLASELRACGID
MSFTPVLDLDYGRSKVIGDRAFHRDPRVVALLAKSVNHGLALAGMANCGKHFPGHGFAQA
DSHVALPTDDRPLDEILANDAAPYDWLGLSLSAVIPAHVIYTQVDSKPAGFSRVWLQDVL
RGRLRFAGAVFSDDLSMEAAREGGTLAQSAQAALEAGCDMVLVCNQPDAAERVLDELRTT
ASRESSRRIKQMRPRGKALEWRKLMREPRYLNAQSLLRSTFA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgccccccggtccggtgatgctcgacgtcgccggcacgacgctcacgcgcgac
gacgcgcgccgcctcgcgcatccgcacacgggcggcgtgatcctgttcgcgcgccacttc
gagagccgcgcgcaactcgtcgcgctgaccgaggcgatccgggcgatccgcgacggcatc
ctgatcgcggtcgatcacgagggcggccgcgtgcagcgctttcgcaccgacggcttcacc
gtgctgccggcgatgcgccggctcggcgagctgtgggacaaggacgtgctgcacgcgacg
aaggcggcgaccgcgctcggctatgtgctcgcttccgagctgcgcgcgtgcggcatcgac
atgagcttcacgcccgtgctcgatctcgattacggccgctcgaaggtgatcggcgatcgc
gcgttccatcgcgatccgcgcgtcgtcgcgttgctcgcgaagagcgtcaaccacgggctc
gcgctcgccgggatggcgaactgcggcaagcattttcccggccacggcttcgcgcaggcc
gattcgcacgtcgcgctgccgaccgacgatcgtccgctcgacgagatcctcgcgaacgac
gcggcgccgtacgactggctcgggctgtcgttgtcggccgtcattccggcgcacgtgatc
tacacgcaagtcgattcgaagccggccggcttctcgcgcgtgtggttgcaggacgtgctg
cgcggccggctgcgctttgcgggcgccgtgttcagcgacgatctgtcgatggaggccgcg
cgcgagggcggcacgctcgcgcagtcggcgcaggccgcactcgaggcgggctgcgacatg
gtgctcgtgtgcaaccagccggatgcggcggagcgggtgctcgacgagctgcgcacgacg
gcgtcgcgcgaatcgtcgcggcggatcaagcagatgcggccgcgcggcaaggcgctcgag
tggcgcaagctgatgcgcgagccgcgctatctgaatgcgcagagcctgttgcgcagcacg
ttcgcctga

DBGET integrated database retrieval system