KEGG   Burkholderia mallei NCTC 10229: BMA10229_A3091Help
Entry
BMA10229_A3091    CDS       T00471                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase E2 component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
bml00010  Glycolysis / Gluconeogenesis
bml00020  Citrate cycle (TCA cycle)
bml00620  Pyruvate metabolism
bml01100  Metabolic pathways
bml01110  Biosynthesis of secondary metabolites
bml01120  Microbial metabolism in diverse environments
bml01130  Biosynthesis of antibiotics
bml01200  Carbon metabolism
Module
bml_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BMA10229_A3091 (aceF)
   00020 Citrate cycle (TCA cycle)
    BMA10229_A3091 (aceF)
   00620 Pyruvate metabolism
    BMA10229_A3091 (aceF)
Enzymes [BR:bml01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BMA10229_A3091 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_D23 NQRA
Motif
Other DBs
NCBI-ProteinID: ABN01831
UniProt: A2SAR3
Position
I:3126207..3127796
Genome map
AA seq 529 aa AA seqDB search
MSQAIEVKVPDIGDYKDVPVIEVLVKPGDAVEPEQSLVTLESDKATMDVPSPSAGTVKEV
KVKVGDAVSQGSLIVLLDGAQAAAQPAQANGAATSAAQPAAAPAAAPAPAAAAGGGTVDV
KVPDIGDYKDVPVIEIAVKIGDTVEKEQSLVTLESDKATMDVPSPAAGVVKDIKVKVGDA
VSEGSLIVVLEASGGAAASAPQAAPAAAPAPAQAPAPAASGEYRASHASPSVRKFARELG
VDVSRVTGTGPKSRITKDDVTAFVKGVMTGQRAAPGAAAAPAGGGELNLLPWPKVDFSKF
GPFEAKPLSRIKKISGANLHRNWVMIPHVTNNDEADITELEALRVQLNKEHEKAGVKFTM
LAFVIKAVVAALKKFPTFNASLDGDNLVFKQYYHIGFAADTPNGLVVPVIRDADKKGLVD
IAKEMAELSKAAREGKLKPDQMQGGCFSISSLGGIGGTHFTPIINAPEVAILGLSRGQMK
PVWDGKQFVPRLTLPLSLSYDHRVIDGAEAARFNAYLGALLADFRRIIL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgatcgaagtcaaggtgccggatatcggcgattacaaggacgtgcccgtc
atcgaagtgctcgtgaagccgggcgatgcggtcgagcccgagcagtcgctcgtcacgctc
gaatcggacaaggcgacgatggatgtgccgagcccgtcggcgggcacggtcaaggaagtg
aaggtgaaggtcggcgacgcggtgtcgcaaggctcgctgatcgtgctgctcgacggcgcg
caggcggcggcccagcccgcgcaggcgaacggcgccgcgacgagcgccgcgcagccggcg
gcggcgcccgctgccgcgcctgcgccggcggcggccgcgggcggcggcacggtcgacgtg
aaggtgccggacatcggcgactacaaggacgtgcccgtcatcgagatcgccgtgaagatc
ggcgacacggtcgagaaggagcagtcgctcgtcacgctcgaatcggacaaggcgacgatg
gacgtgccgagcccggccgcgggcgtcgtcaaggacatcaaggtaaaggtcggcgatgcg
gtgtcggaaggttcgctgatcgtcgtgctcgaagcgtcgggcggcgccgccgcgagcgcg
ccgcaggccgcacccgcggctgcgccggcccccgcgcaggcaccggcacccgccgcgagc
ggcgagtaccgcgcgagccacgcgtcgccgtcggtgcgcaagttcgcgcgcgagctcggc
gtcgacgtgtcgcgcgtcacgggcacggggccgaagagccgcatcacgaaggacgacgtc
accgcgttcgtgaagggcgtgatgacggggcagcgcgcggcgcccggcgctgcggccgcg
cccgcgggcggcggcgagctgaacctgctgccgtggccgaaggtcgacttctcgaagttc
ggcccgttcgaggcgaagccgctgtcgcgcatcaagaagatctcgggcgcgaacctgcat
cgcaactgggtgatgatcccgcacgtcacgaacaacgacgaggcggacatcaccgagctc
gaagcgctgcgcgtgcaactgaacaaggagcacgagaaggcgggcgtgaagttcacgatg
ctcgcgttcgtgatcaaggcggtcgtcgccgcgctgaagaagttcccgaccttcaacgcg
agcctcgacggcgacaacctcgtgttcaagcagtactaccacatcggtttcgccgccgac
acgccgaacggcctcgtcgtgccggtgatccgcgacgcggacaagaaggggctcgtcgac
atcgcgaaggaaatggccgagctgtcgaaggccgcgcgcgaaggcaagctcaagccggac
cagatgcagggcggctgcttctcgatctcgtcgctcggcgggatcggcggcacgcacttc
acgccgatcatcaatgcgccggaagtggcgatcctcgggctgtcgcgcggccagatgaag
ccggtgtgggacggcaagcagtttgtgccgcgcctcacgctgccgctgtcgctgtcgtat
gaccatcgcgtgatcgatggcgcggaagccgcgcggttcaatgcgtatctcggcgcgttg
cttgccgatttccgtcgcatcattctttga

DBGET integrated database retrieval system