KEGG   Burkholderia mallei NCTC 10229: BMA10229_A3224Help
Entry
BMA10229_A3224    CDS       T00471                                 

Gene name
aceA
Definition
(RefSeq) isocitrate lyase (EC:4.1.3.1)
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bml00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BMA10229_A3224 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BMA10229_A3224 (aceA)
Enzymes [BR:bml01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     BMA10229_A3224 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3269902..3271329)
Genome map
AA seq 475 aa AA seqDB search
MPRLLYKTSRTKPPNPNRAVRFAQSKISSLQATTTQGVRIMSRQQQAQELQKQWETDPRW
KGIKRAFTAEDVVRLRGSIQQEHTLAKRGAEKLWTLINNEPFVNALGALTGNQAMQQVKA
GLKAIYLSGWQVAGDANVAGEMYPDQSLYPANSVPLVVKRINNTLTRADQIQWSEGKNPG
DEGYVDFFAPIVADAEAGFGGVLNAFELMKAMIEAGASGVHFEDQLASVKKCGHMGGKVL
VPTREAVAKLTAARLAADVMGTPTVLVARTDAEAADLITSDIDDNDKPYLTGERTVEGFF
RTKPGLEQAISRGLAYAPYADLIWCETGKPDLEYAKKFAEAIHKQFPGKLLSYNCSPSFN
WKKNLDDATIAKFQKELGAMGYKFQFITLAGFHALNYSMFNLAHGYARTQMSAFVELQQA
EFAAADKGFTAVKHQREVGTGYFDAVTQTVEREASTTALHGSTEDEQFFDGQKVA
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
ttgcctagactcttatacaagacttcacgaacgaaaccgccgaatcccaatcgcgccgtc
cgtttcgcccagtcaaagatttcttctcttcaggcaacgaccactcaaggagtacgcatc
atgtcgcgtcaacaacaggctcaggaactgcaaaagcaatgggaaaccgatccgcgctgg
aagggcatcaagcgcgcgttcaccgctgaggacgtcgtgcgcctgcgcggctcgatccag
caagagcacacgctcgcgaagcgcggcgcggaaaagctctggacgctcatcaacaacgag
ccgttcgtcaacgcactcggcgcgctgacgggcaaccaggcgatgcagcaggtcaaggcc
ggcctcaaggcgatctatctgtcgggctggcaagtcgcgggcgacgcgaacgtcgcgggc
gaaatgtatccggaccagtcgctgtacccggcgaactcggtgccgctcgtcgtcaagcgc
atcaacaacacgctcacgcgcgccgatcagatccagtggtcggaaggcaagaaccccggc
gacgaaggctatgtcgacttcttcgcgccgatcgtcgccgacgcggaagccggcttcggc
ggcgtgctgaacgcgttcgaactgatgaaggcgatgatcgaggcgggcgcgtcgggcgtt
cacttcgaagaccagctcgcctcggtcaagaagtgcggccacatgggcggcaaggtgctc
gtgccgacccgcgaggcggtcgcgaagctgacggccgcgcgtctcgccgccgacgtgatg
ggcacgccgaccgtgctggtcgcgcgcaccgacgccgaagcggccgacctgatcacgtcc
gacatcgacgacaacgacaagccgtacctgacgggcgagcgcacggtcgaaggcttcttc
cgcacgaagccgggcctcgagcaggcgatctcgcgcggcctcgcctatgcgccgtacgcc
gacctgatctggtgcgaaaccggcaagccggatctcgaatacgcgaagaagttcgcggaa
gcgatccacaagcagttcccgggcaagctgctgtcgtacaactgctcgccgtcgttcaac
tggaagaagaacctcgacgacgcgacgatcgcgaagttccagaaggaactcggcgcgatg
ggctacaagttccagttcatcacgctcgccggcttccatgcgctgaactactcgatgttc
aacctcgcgcacggctacgcccgcacgcagatgagcgcgttcgtcgaactgcagcaagcc
gagttcgcggcggccgacaagggcttcaccgcggtcaagcaccagcgtgaagtcggcacc
ggctacttcgacgcggtgacgcagacggtcgagcgcgaagcgtcgacgaccgcgctgcac
ggctcgaccgaagacgaacagttcttcgacggccagaaagtcgcctga

DBGET integrated database retrieval system