KEGG   Burkholderia mallei NCTC 10229: BMA10229_A3241Help
Entry
BMA10229_A3241    CDS       T00471                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bml01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bml00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3290244..3291383)
Genome map
AA seq 379 aa AA seqDB search
MSATLALTEQLIARASVTPDDQHCQQLMIERLAALGFECETIASHGVTNFWAVKRGTAGR
AGKLLAFAGHTDVVPTGPLEQWRSPPFVPTHRDGKLYGRGAADMKTSLAGFVVAAEEFVA
AHPQHRGSIGFLITSDEEGPATDGTVKVVEALAARGERLDYCIVGEPTSTATLGDVVKNG
RRGSMSGELVVKGVQGHIAYPHLAKNPIHLLAPALAELAAEQWDEGNEYFPPTTWQVSNL
RAGTGATNVIPGHADLLFNFRFSTASTVEGLQARVHAILDRHGLDYTLNWSVSGLPFLTP
RGELSNALDAAIRAETGVSPELSTTGGTSDGRFIARICPQVIEFGPPNASIHKIDEHIDV
RFVDPLKNVYRRVLEQLIA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccacccttgccctcaccgaacagttgatcgcgcgcgcgtccgtcacgcccgac
gatcagcactgccagcaattgatgatcgagcgcctcgccgccctcggcttcgagtgcgaa
acgatcgcgtcgcacggcgtgacgaacttctgggccgtcaagcgcggcacggccggccgc
gcaggcaagctgctcgcgttcgcgggccataccgacgtcgtgccgaccggcccgctcgag
cagtggcgctcgccgccgttcgtgccgacgcaccgcgacggcaagctgtacggccgcggc
gcggccgacatgaaaacctcgctcgcgggcttcgtcgtcgcggccgaggagttcgtcgcc
gcgcatccgcagcaccgcggctcgatcggtttcctgatcacgagcgacgaggaaggcccg
gccaccgacggcaccgtgaaagtcgtcgaggcgctcgccgcgcgcggcgagcgcctcgat
tactgcatcgtcggcgaaccgacctcgacggcgacgctcggcgacgtcgtgaagaacggc
cggcgcggctcgatgtcgggcgagctcgtcgtcaagggcgtgcaaggccatatcgcgtat
ccgcatctcgcgaagaacccgatccatctgctcgcgccggcgctcgccgagctcgccgcc
gagcaatgggacgaaggcaacgagtactttccgccgaccacctggcaggtgtcgaacctg
cgcgcgggcaccggcgcgacgaacgtgattccgggccacgccgatctgctgttcaacttc
cgcttctcgacggcgagcacggtcgagggcctgcaggcgcgcgtgcacgcgatcctcgac
aggcacgggctcgattacacgctgaactggtcggtgagcggcctgccgttcctcacgccg
cgcggcgagctgtcgaacgcgctcgacgccgcgatccgcgcggaaacgggcgtctcgccc
gagctgtcgacgacgggcggcacgtccgacggccgcttcatcgcgcgcatctgcccgcag
gtgatcgagttcggcccgccgaacgcgagcatccacaagatcgacgagcacatcgacgtg
cgcttcgtcgacccgctgaagaacgtgtaccgccgcgtgctcgaacaactgatcgcctga

DBGET integrated database retrieval system