KEGG   Burkholderia mallei NCTC 10229: BMA10229_A3360Help
Entry
BMA10229_A3360    CDS       T00471                                 

Gene name
tesA
Definition
acyl-CoA thioesterase (EC:3.1.2.-)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bml  Burkholderia mallei NCTC 10229
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bml01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
I:complement(3411175..3411855)
Genome map
AA seq 226 aa AA seqDB search
MSMKRTVHWKAGATLAVVATFAGPASAATNAAPAPNADGGKPVIVVLGDSLSAEYGLPRD
TGWVALMRARLAAERIDYSVANASISGDTTSGGRARLPAVLARLKPAVVVVELGANDALR
GVPLAATEGNLREIVAQARQARAQVLLVGMYVPSNYGPDYTQKFHGVYTGLSKEMRVPLV
PFLLAGIENKPDMFQADQIHPTQAAQRQLLDNVWPALKPLLRTSSR
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
ttgagcatgaaacgcacagttcactggaaggccggcgcgacgctcgccgtggtcgcgacg
ttcgccggcccggcatccgccgccacgaatgcagcgcccgcgccgaacgccgacggcggc
aagccggtgatcgtcgtgctcggcgacagcctgtcggccgaatacggcctgccgcgcgat
acgggctgggtcgcgctgatgcgcgcgcgcctcgcggccgagcgaatcgattatagcgtc
gcgaacgcgagcatctccggcgacacgacgagcggcggccgcgcgcggctgcccgcggtg
ctcgcacggctcaagccggccgtcgtcgtcgtcgaactcggcgcgaacgacgcgctgcgc
ggcgtgccgctcgccgcgaccgaaggcaacctgcgcgagatcgtcgcgcaggcgcggcag
gcgcgcgcgcaggtgctgctcgtcggcatgtacgtgccgtcgaattacggcccggactac
acgcaaaagttccacggcgtctacacggggctgtccaaggagatgcgcgtgccgctcgtg
ccgttcctgctcgccggcatcgagaacaagcccgacatgttccaggccgaccagatccat
ccgacgcaggccgcgcagcgccagttgctcgacaacgtatggccggccctcaagccgctg
ctgcggacgtcatcgcgctga

DBGET integrated database retrieval system