KEGG   Blattabacterium MADAR (Mastotermes darwiniensis): MADAR_005Help
Entry
MADAR_005         CDS       T01642                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase, E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bmm  Blattabacterium MADAR (Mastotermes darwiniensis)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bmm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MADAR_005 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MADAR_005 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    MADAR_005 (sucB)
Enzymes [BR:bmm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MADAR_005 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6068..7195)
Genome map
AA seq 375 aa AA seqDB search
MAEYNLTLPSMGESIAEATIIRWLKKEGDSVKKEDLLVEIATDKVDSEIYSPVNGILKKK
LFYPNEVAKVGSSIAILEIEEKNIGTRFYSPFVRTLAHQEGISFYELESIEGTGKKGRVT
KKDILKYIQNKKENILHPHNEEIIEMDRIRQITASHMISSKNISAHVTSFVEADVTNIVK
WRNKMKDIFQKNTGEKLTLMSVFVKCVVKAIKDLPMINISVHGTNIIKKKNIHIGLATAL
PNGNLIVPVIKHADSYSLRGLIKIINDLIRRAKSNQLKPEETQGGTYTISNIGSFGNIFG
TPIIHQPQVAIMAIGLIQKKLSIIETPKGDFIGIRHKIYLSHSYDHRVINGELGGEFAKK
VALYLEEFNCYTKII
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggccgagtataatttgacccttccatccatgggtgaaagtatagctgaggctactatc
attcgttggttaaagaaagaaggagattctgtaaaaaaagaagatttattggtagaaata
gctacagataaagttgattctgaaatttattctcccgtgaatggaatattgaaaaagaaa
ttattttatccaaatgaagtagcaaaggtaggaagttccatagctattttagaaatagag
gaaaaaaatataggaacaagattttactctccttttgttcgtactcttgctcatcaagaa
ggaattagtttttatgaattagaatccatagaaggaactggaaaaaaaggtcgtgttact
aaaaaggatatattgaagtatattcagaataaaaaagaaaatatacttcatcctcataat
gaggaaattatagaaatggatagaattcgtcaaattacagcctctcatatgattagtagt
aagaatatatctgctcatgttacttcttttgttgaagcagatgtcacaaacatagtgaaa
tggagaaataaaatgaaggatatttttcaaaaaaatacaggagaaaaattgactttaatg
tctgtatttgtaaaatgtgtagttaaagctataaaagacctccctatgatcaatatttct
gtacatggaactaatattataaaaaaaaaaaatattcatataggattagctacagcattg
cctaatggcaatttaattgttcctgtgattaaacatgcagattcctatagtttaagaggt
ttaataaaaattatcaatgatttaataagaagagctaaatccaatcaattaaaacctgaa
gaaacccaaggaggtacttatacaattagtaatataggtagttttggaaatatatttgga
actcctattatacatcaacctcaagttgcaattatggcaataggattaatacaaaaaaaa
ctttctattatagaaactccaaaaggagattttattggaataagacacaaaatttatttg
tcacattcctatgatcatcgtgtaataaatggagaacttggaggtgaatttgctaaaaaa
gtagcattatatttggaagaatttaattgttataccaaaataatatga

DBGET integrated database retrieval system