KEGG   Blattabacterium sp. (Mastotermes darwiniensis): MADAR_005Help
Entry
MADAR_005         CDS       T01642                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase, E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bmm  Blattabacterium sp. (Mastotermes darwiniensis)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bmm01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bmm00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:bmm00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6068..7195)
Genome map
AA seq 375 aa AA seqDB search
MAEYNLTLPSMGESIAEATIIRWLKKEGDSVKKEDLLVEIATDKVDSEIYSPVNGILKKK
LFYPNEVAKVGSSIAILEIEEKNIGTRFYSPFVRTLAHQEGISFYELESIEGTGKKGRVT
KKDILKYIQNKKENILHPHNEEIIEMDRIRQITASHMISSKNISAHVTSFVEADVTNIVK
WRNKMKDIFQKNTGEKLTLMSVFVKCVVKAIKDLPMINISVHGTNIIKKKNIHIGLATAL
PNGNLIVPVIKHADSYSLRGLIKIINDLIRRAKSNQLKPEETQGGTYTISNIGSFGNIFG
TPIIHQPQVAIMAIGLIQKKLSIIETPKGDFIGIRHKIYLSHSYDHRVINGELGGEFAKK
VALYLEEFNCYTKII
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggccgagtataatttgacccttccatccatgggtgaaagtatagctgaggctactatc
attcgttggttaaagaaagaaggagattctgtaaaaaaagaagatttattggtagaaata
gctacagataaagttgattctgaaatttattctcccgtgaatggaatattgaaaaagaaa
ttattttatccaaatgaagtagcaaaggtaggaagttccatagctattttagaaatagag
gaaaaaaatataggaacaagattttactctccttttgttcgtactcttgctcatcaagaa
ggaattagtttttatgaattagaatccatagaaggaactggaaaaaaaggtcgtgttact
aaaaaggatatattgaagtatattcagaataaaaaagaaaatatacttcatcctcataat
gaggaaattatagaaatggatagaattcgtcaaattacagcctctcatatgattagtagt
aagaatatatctgctcatgttacttcttttgttgaagcagatgtcacaaacatagtgaaa
tggagaaataaaatgaaggatatttttcaaaaaaatacaggagaaaaattgactttaatg
tctgtatttgtaaaatgtgtagttaaagctataaaagacctccctatgatcaatatttct
gtacatggaactaatattataaaaaaaaaaaatattcatataggattagctacagcattg
cctaatggcaatttaattgttcctgtgattaaacatgcagattcctatagtttaagaggt
ttaataaaaattatcaatgatttaataagaagagctaaatccaatcaattaaaacctgaa
gaaacccaaggaggtacttatacaattagtaatataggtagttttggaaatatatttgga
actcctattatacatcaacctcaagttgcaattatggcaataggattaatacaaaaaaaa
ctttctattatagaaactccaaaaggagattttattggaataagacacaaaatttatttg
tcacattcctatgatcatcgtgtaataaatggagaacttggaggtgaatttgctaaaaaa
gtagcattatatttggaagaatttaattgttataccaaaataatatga

DBGET integrated database retrieval system