KEGG   Blattabacterium MADAR (Mastotermes darwiniensis): MADAR_014Help
Entry
MADAR_014         CDS       T01642                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bmm  Blattabacterium MADAR (Mastotermes darwiniensis)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bmm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MADAR_014 (folK)
Enzymes [BR:bmm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     MADAR_014 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
16538..17062
Genome map
AA seq 174 aa AA seqDB search
MKEHKVFLFQGSNKGNRKKYLDESLSLIYKKIGKIVQKSSYFESEAWNMNKKTYPFYNRA
LCIKTFHSPIDLLEEIYDIESCIGRTNKSDLFSSQEKYKDREIDIDILFYDHMVIQSSIL
TIPHPLLHFRRFVLEPMCEIAPKKYHPIFHLTVLEMLGVCMDDLKIKKLGNFIP
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaacacaaagtatttttatttcaaggaagtaataaaggaaatagaaaaaaatat
ttagatgaatcattgtccttaatttacaaaaagattggaaaaatagttcaaaaatcttct
tattttgaaagcgaagcttggaatatgaataaaaaaacatatcctttttacaatagggca
ttgtgtataaaaacatttcattctcctattgatcttttagaagaaatttatgatattgaa
tcttgcataggtagaactaataaaagtgacttattttcttctcaagaaaaatataaagat
agagaaattgatatagatattttgttttacgatcacatggtaatccaaagttctatttta
actatcccacatcctttgttacattttcgtagatttgttttagaacctatgtgtgagata
gccccaaaaaaatatcaccctatatttcatcttactgtcttggaaatgttaggagtttgt
atggatgatttaaaaattaaaaaactaggtaattttattccatag

DBGET integrated database retrieval system